spacer

EBI Dbfetch

ID   M17387; SV 1; linear; mRNA; STD; HUM; 258 BP.
XX
AC   M17387;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class II HLA-DR-beta mRNA (DR9), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-258
RX   DOI; 10.1073/pnas.84.17.6234.
RX   PUBMED; 3476943.
RA   Bell J.I., Denney D.Jr., Foster L., Belt T.K., Todd J.A., McDevitt H.O.;
RT   "Allelic variation in the DR subregion of the human major
RT   histocompatibility complex";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(17):6234-6238(1987).
XX
DR   MD5; 823d013149d0d3399d0a058dce7ebbe4.
DR   Ensembl-Gn; ENSG00000229074; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236884; homo_sapiens.
DR   Ensembl-Tr; ENST00000437784; homo_sapiens.
DR   Ensembl-Tr; ENST00000444645; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..258
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>258
FT                   /codon_start=1
FT                   /note="MHC HLA-DR-beta cell surface glycoprotein"
FT                   /db_xref="GOA:Q9TQE0"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*09:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /protein_id="AAA36297.1"
FT                   /translation="GDTQPRFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVG
FT                   EYRAVTELGRPVAESWNSQKDFLERRRAEVDTVCRHNYGVG"
XX
SQ   Sequence 258 BP; 57 A; 61 C; 96 G; 44 T; 0 other;
     ggggacaccc aaccacgttt cttgaagcag gataagtttg agtgtcattt cttcaacggg        60
     acggagcggg tgcggtatct gcacagaggc atctataacc aagaggagaa cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctgt cgccgagtcc       180
     tggaacagcc agaaggactt cctggagcgg aggcgggccg aggtggacac cgtgtgcaga       240
     cacaactacg gggttggt                                                     258
//


spacer
spacer