spacer

EBI Dbfetch

ID   M17385; SV 1; linear; mRNA; STD; HUM; 714 BP.
XX
AC   M17385;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DR-beta mRNA (DR7), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-714
RX   DOI; 10.1073/pnas.84.17.6234.
RX   PUBMED; 3476943.
RA   Bell J.I., Denney D.Jr., Foster L., Belt T.K., Todd J.A., McDevitt H.O.;
RT   "Allelic variation in the DR subregion of the human major
RT   histocompatibility complex";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(17):6234-6238(1987).
XX
DR   MD5; 0611b019618e153ec92efdf9a5e229c9.
DR   H-InvDB; HIT000194535_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..714
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..714
FT                   /codon_start=1
FT                   /note="MHC HLA-DR-beta cell surface glycoprotein"
FT                   /db_xref="GOA:Q30152"
FT                   /db_xref="H-InvDB:HIT000194535_02.4"
FT                   /db_xref="IMGT/HLA:DRB4*01:01:01:01"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30152"
FT                   /protein_id="AAA36300.1"
FT                   /translation="GDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLG
FT                   EYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPS
FT                   KTQPLQHHNLLVCSVSGFYPASIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLET
FT                   VPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFR
FT                   NQKGHSGLQPTGLLS"
XX
SQ   Sequence 714 BP; 167 A; 177 C; 227 G; 143 T; 0 other;
     ggggacaccc aaccacgttt cttggagcag gctaagtgtg agtgtcattt cctcaatggg        60
     acggagcgag tgtggaacct gatcagatac atctataacc aagaggagta cgcgcgctac       120
     aacagtgacc tgggggagta ccaggcggtg acggagctgg ggcggcctga cgctgagtac       180
     tggaacagcc agaaggacct cctggagcgg aggcgggccg aggtggacac ctactgcaga       240
     tacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccaacc taaggtgact       300
     gtgtatcctt caaagaccca gcccctgcag caccacaacc tcctggtctg ctctgtgagt       360
     ggtttctatc cagctagcat tgaagtcagg tggttccgga acggccagga agagaaggct       420
     ggggtggtgt ccacaggcct gatccagaat ggagactgga ccttccagac cctggtgatg       480
     ctggaaacag ttcctcggag tggagaggtt tacacctgcc aagtggagca tccaagcatg       540
     atgagccctc tcacggtgca atggagtgca cggtctgaat ctgcacagag caagatgctg       600
     agtggagtcg ggggctttgt gctgggcctg ctcttccttg ggacagggct gttcatctac       660
     ttcaggaatc agaaaggaca ctctggactt cagccaacag gactcttgag ctga             714
//


spacer
spacer