spacer

EBI Dbfetch

ID   M17384; SV 1; linear; mRNA; STD; HUM; 714 BP.
XX
AC   M17384;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class II HLA-DR-beta mRNA (DR7), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-714
RX   DOI; 10.1073/pnas.84.17.6234.
RX   PUBMED; 3476943.
RA   Bell J.I., Denney D.Jr., Foster L., Belt T.K., Todd J.A., McDevitt H.O.;
RT   "Allelic variation in the DR subregion of the human major
RT   histocompatibility complex";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(17):6234-6238(1987).
XX
DR   MD5; d425620ae5b757bc506c4c118a1e8c21.
DR   H-InvDB; HIT000194534_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..714
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..714
FT                   /codon_start=1
FT                   /note="MHC HLA-DR-beta cell surface glycoprotein"
FT                   /db_xref="GOA:Q30148"
FT                   /db_xref="H-InvDB:HIT000194534_02.4"
FT                   /db_xref="IMGT/HLA:DRB1*07:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30148"
FT                   /protein_id="AAA36295.1"
FT                   /translation="GDTQPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVG
FT                   EYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYPA
FT                   KTRPLQHHNLLVCSVSGFYPASIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLET
FT                   VPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
FT                   NQKGHSGLQPTGFLS"
XX
SQ   Sequence 714 BP; 156 A; 178 C; 235 G; 145 T; 0 other;
     ggggacaccc aaccacgttt cctgtggcag ggtaagtata agtgtcattt cttcaacggg        60
     acggagcggg tgcagttcct ggaaagactc ttctataacc aggaggagtt cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctag ggcggcctgt cgccgagtcc       180
     tggaacagcc agaaggacat cctggaggac aggcggggcc aggtggacac cgtgtgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc gagtccatcc tgaggtgact       300
     gtgtatcctg ccaagactcg gcccctgcag caccacaacc tcctggtctg ctctgtgagt       360
     ggtttctatc cagccagcat tgaagtcagg tggttccgga acggccagga agagaaggct       420
     ggggtggtgt ccacaggcct gatccagaat ggagactgga ccttccagac cctggtgatg       480
     ctggaaacag ttcctcggag tggagaagtt tacacctgcc aagtggagca cccaagtgtg       540
     atgagccctc tcacagtgga atggagagca cggtctgaat ctgcacagag caagatgctg       600
     agtggagtcg ggggctttgt gctgggcctg ctcttccttg gggccgggtt gttcatctac       660
     ttcaggaatc agaaaggaca ctctggactt cagccaacag gattcctgag ctga             714
//


spacer
spacer