spacer

EBI Dbfetch

ID   M17382; SV 1; linear; mRNA; STD; HUM; 714 BP.
XX
AC   M17382;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human MHC class II HLA-DR-beta mRNA (DR5), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-714
RX   DOI; 10.1073/pnas.84.17.6234.
RX   PUBMED; 3476943.
RA   Bell J.I., Denney D.Jr., Foster L., Belt T., Todd J.A., McDevitt H.O.;
RT   "Allelic variation in the DR subregion of the human major
RT   histocompatibility complex";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(17):6234-6238(1987).
XX
DR   MD5; 8a1d14864fb51a8f2d011fbb5dcd2c22.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..714
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..714
FT                   /codon_start=1
FT                   /gene="HLA-DRB5"
FT                   /note="MHC HLA-DR-beta cell surface glycoprotein"
FT                   /db_xref="GOA:Q30151"
FT                   /db_xref="IMGT/HLA:DRB1*11:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30151"
FT                   /protein_id="AAA59819.1"
FT                   /translation="GDTRPRFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVG
FT                   EFRAVTELGRPDEEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRRVHPKVTVYPS
FT                   KTQPLQHHNLLVCSVSGFYPASIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLET
FT                   FPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
FT                   NQKGHSGLQPRGFLS"
XX
SQ   Sequence 714 BP; 161 A; 178 C; 228 G; 147 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttctataacc aagaggagta cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga tgaggagtac       180
     tggaacagcc agaaggacat cctggaagac gagcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccatcc taaggtgact       300
     gtgtatcctt caaagaccca gcccctgcag caccacaacc tcctggtctg ttctgtgagt       360
     ggtttctatc cagccagcat tgaagtcagg tggttccgga atggccagga agagaagact       420
     ggggtggtgt ccacaggcct gatccacaat ggagactgga ccttccagac cctggtgatg       480
     ctggaaacat tccctcggag tggagaggtt tacacctgcc aagtggagca cccaagcgtg       540
     acaagccctc tcacagtgga atggagagca cggtctgaat ctgcacagag caagatgctg       600
     agtggagtcg ggggctttgt gctgggcctg ctcttccttg gggccgggct gttcatctac       660
     ttcaggaatc agaaaggaca ctctggactt cagccaagag gattcctgag ctga             714
//


spacer
spacer