Dbfetch

ID   M17380; SV 1; linear; mRNA; STD; HUM; 714 BP.
XX
AC   M17380;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human MHC class II HLA-DR-beta mRNA (DR3), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-714
RX   DOI; 10.1073/pnas.84.17.6234.
RX   PUBMED; 3476943.
RA   Bell J.I., Denney D.Jr., Foster L., Belt T., Todd J.A., McDevitt H.O.;
RT   "Allelic variation in the DR subregion of the human major
RT   histocompatibility complex";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(17):6234-6238(1987).
XX
DR   MD5; 864342e7a08a034210da43cc012dcca1.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..714
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..714
FT                   /codon_start=1
FT                   /gene="HLA-DRB3"
FT                   /note="MHC HLA-DR-beta cell surface glycoprotein"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="H-InvDB:HIT000194530_02.4"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:02:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAA59804.1"
FT                   /translation="GDTRPRFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVG
FT                   EYRAVRELGRPDAEYWNSQKDLLEQKRGQVDNYCRHNYGVVESFTVQRRVHPQVTVYPA
FT                   KTQPLQHHNLLVCSVSGFYPASIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLET
FT                   FPRSGEVYTCQVEHPSVTSPLTVEWSARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFR
FT                   NQKGHSGLQPTGFLS"
XX
SQ   Sequence 714 BP; 157 A; 182 C; 233 G; 142 T; 0 other;
     ggggacaccc gaccacgttt cttggagctg cttaagtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggagagacac ttccataacc aggaggagta cgcgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg agggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacct cctggagcag aagcggggcc aggtggacaa ttactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccatcc tcaggtgact       300
     gtgtatcctg caaagaccca gcccctgcag caccacaacc tcctggtctg ctctgtgagt       360
     ggtttctatc cagccagcat tgaagtcagg tggttccgga acggccagga agagaaggct       420
     ggggtggtgt ccacgggcct gatccagaat ggagactgga ccttccagac cctggtgatg       480
     ctagaaacat ttcctcggag tggagaggtt tacacctgcc aagtggagca cccaagcgta       540
     acgagccctc tcacagtgga atggagtgca cggtctgaat ctgcacagag caagatgctg       600
     agtggagtcg ggggcttcgt gctgggcctg ctcttccttg gggccgggct gttcatctac       660
     ttcaggaatc agaaaggaca ctctggactt cagccaacag gattcctgag ctga             714
//