spacer

EBI Dbfetch

ID   M16958; SV 1; linear; mRNA; STD; HUM; 270 BP.
XX
AC   M16958;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II HLA-DR2 (Dw12) b-associated glycoprotein beta-chain
DE   mRNA, 3' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1073/pnas.84.13.4591.
RX   PUBMED; 2885840.
RA   Lee B.S.M., Rust N.A., McMichael A.J., McDevitt H.O.;
RT   "HLA-DR2 subtypes form an additional supertypic family of DR beta alleles";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(13):4591-4595(1987).
XX
DR   MD5; ea1d99b10e22c29a134ce693ba6167fd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=1
FT                   /note="MHC HLA-DR2(Dw12)b glycoprotein beta-chain"
FT                   /db_xref="GOA:Q29791"
FT                   /db_xref="IMGT/HLA:DRB1*15:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q29791"
FT                   /protein_id="AAA36280.1"
FT                   /translation="GDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVG
FT                   EFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFT"
XX
SQ   Sequence 270 BP; 56 A; 67 C; 99 G; 48 T; 0 other;
     ggggacaccc gaccacgttt cctgtggcag cctaagaggg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttctataacc aggaggagtc cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga cgctgagtac       180
     tggaacagcc agaaggacat cctggagcag gcgcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagctttaca                                        270
//


spacer
spacer