spacer

EBI Dbfetch

ID   M16941; SV 1; linear; mRNA; STD; HUM; 1146 BP.
XX
AC   M16941;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class II HLA-DR7-associated glycoprotein beta- chain mRNA,
DE   complete cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1146
RX   DOI; 10.1073/pnas.84.14.4929.
RX   PUBMED; 3110774.
RA   Young J.A.T., Wilkinson D., Bodmer W.F., Trowsdale J.;
RT   "Sequence and evolution of HLA-DR7- and -DRw53-associated beta-chain
RT   genes";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(14):4929-4933(1987).
XX
DR   MD5; b65ce54ef7ec21bba94db0266095d682.
DR   Ensembl-Gn; ENSG00000229074; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236884; homo_sapiens.
DR   Ensembl-Tr; ENST00000437784; homo_sapiens.
DR   Ensembl-Tr; ENST00000444645; homo_sapiens.
DR   H-InvDB; HIT000194487_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1146
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     24..110
FT                   /note="DR7 beta-chain membrane glycoprotein signal peptide"
FT   CDS             24..824
FT                   /codon_start=1
FT                   /note="DR7 beta-chain glycoprotein"
FT                   /db_xref="GOA:P13761"
FT                   /db_xref="H-InvDB:HIT000194487_02.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*07:01:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13761"
FT                   /protein_id="AAA36282.1"
FT                   /translation="MVCLKLPGGSCMAALTVTLMVLSSPLALAGDTQPRFLWQGKYKCH
FT                   FFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQV
FT                   DTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
FT   mat_peptide     111..821
FT                   /note="DR7 beta-chain membrane glycoprotein"
XX
SQ   Sequence 1146 BP; 245 A; 310 C; 324 G; 267 T; 0 other;
     ctggtcctgt cctgttctcc agcatggtgt gtctgaagct ccctggaggc tcctgcatgg        60
     cagctctgac agtgacactg atggtgctga gctccccact ggctttggct ggggacaccc       120
     aaccacgttt cctgtggcag ggtaagtata agtgtcattt cttcaacggg acggagcggg       180
     tgcagttcct ggaaagactc ttctataacc aggaggagtt cgtgcgcttc gacagcgacg       240
     tgggggagta ccgggcggtg acggagctag ggcggcctgt cgccgagtcc tggaacagcc       300
     agaaggacat cctggaggac aggcggggcc aggtggacac cgtgtgcaga cacaactacg       360
     gggttggtga gagcttcaca gtgcagcggc gagtccatcc tgaggtgact gtgtatcctg       420
     ccaagactca gcccctgcag caccacaacc tcctggtctg ctctgtgagt ggtttctatc       480
     caggcagcat tgaagtcagg tggttccgga acggccagga agagaaggct ggggtggtgt       540
     ccacaggcct gatccagaat ggagactgga ccttccagac cctggtgatg ctggaaacag       600
     ttcctcggag tggagaagtt tacacctgcc aagtggagca cccaagtgtg atgagccctc       660
     tcacagtgga atggagagca cggtctgaat ctgcacagag caagatgctg agtggtgtcg       720
     ggggctttgt gctgggcctg ctcttccttg gggccgggtt gttcatctac ttcaggaatc       780
     agaaaggaca ctctggactt cagccaacag gattcctgag ctgaagtgaa gatgaccaca       840
     ttcaaggaaa aaccttctgc cccagctttg caggatgaaa cacttcccgc ttggctctca       900
     ttcttccaca agagagacct ttctccggac ctggttgcta ctggttcagc aactgcagaa       960
     aatgtcctcc cctgtggctg cctcagctca tgcctttggc ctgaagtccc agcattgatg      1020
     gcagcccctc atcttccaag ttttgtgctc ccctttacct aacgcttcct gcctcccatg      1080
     catctgtact cctcctgtgc cacaaacaca ttacattatt aaatgtttct caaacatgga      1140
     gttaaa                                                                 1146
//


spacer
spacer