spacer

EBI Dbfetch

ID   M16102; SV 1; linear; mRNA; STD; HUM; 1521 BP.
XX
AC   M16102;
XX
DT   02-APR-1988 (Rel. 15, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC HLA-B7 class I cell surface glycoprotein heavy chain mRNA,
DE   complete cds.
XX
KW   antigen; cell surface antigen; cell surface glycoprotein; class I gene;
KW   glycoprotein; histocompatibility antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1521
RX   DOI; 10.1007/BF00563508.
RX   PUBMED; 2993161.
RA   Sood A.K., Pan J., Biro P.A., Pereira D., Srivastava R., Reddy V.B.,
RA   Duceman B.W., Weissman S.M.;
RT   "Structure and polymorphism of class I MHC antigen mRNA";
RL   Immunogenetics 22(2):101-121(1985).
XX
DR   MD5; 8838989c7338567bef46c2c49afe9896.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
XX
CC   Except for the changes listed in FEATURES, the sequence below is
CC   from figure 2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1521
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..1521
FT                   /note="HLAB7 mRNA"
FT   sig_peptide     11..79
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B7 heavy chain signal peptide"
FT   CDS             11..1096
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B7 heavy chain precursor"
FT                   /db_xref="GOA:P01889"
FT                   /db_xref="H-InvDB:HIT000194436.14"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*07:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:3VCL"
FT                   /protein_id="AAA59622.1"
FT                   /translation="MLVMAPRTVLLLLSGPWLTETWAGSHSMRYFYTSVSRPXXGEPRF
FT                   ISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNL
FT                   RGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAA
FT                   QITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEA
FT                   TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKSAAVVVPSGEEQRYT
FT                   CHVQHEGLPKPLTLGWEPSSQSTVPIVGIVARPAVLAVVVIGAVVAAVMCRRKSSGGKG
FT                   GSYSQAACSDSAQGSDVSLTA"
FT   mat_peptide     80..1093
FT                   /gene="HLA-B"
FT                   /note="MHC HLA-B7 heavy chain"
FT   unsure          122..124
FT                   /gene="HLA-B"
FT                   /note="ccc in fig 3; cc in fig 2"
FT   unsure          422
FT                   /gene="HLA-B"
FT                   /note="c in fig 3; x in fig 2"
FT   unsure          562..564
FT                   /gene="HLA-B"
FT                   /note="ggg in fig 3; gggg in fig 2"
FT   unsure          888..892
FT                   /gene="HLA-B"
FT                   /note="tcacc in fig 3; thaca in fig 2"
XX
SQ   Sequence 1521 BP; 328 A; 425 C; 456 G; 306 T; 6 other;
     agacgccgag atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggggccctg        60
     gctgaccgag acctgggcgg ggtcccactc catgaggtat ttctacacat ccgtgtcccg       120
     gcccnnnnnn ggggagcccc gcttcatctc agtgggctac gtggacgaca cccagttcgt       180
     gaggttcgac agcgacgccg cgagtccgag agaggagccg cgggcgccgt ggatagagca       240
     ggaggggccg gagtattggg accggaacac acagatctac aaggcccaag cacagactga       300
     ccgagagagc ctgcggaacc tgcgcggcta ctacaaccag agcgaggctg ggtctcacac       360
     ccttcagagc atgtacggtt gcgacgtggg gccggacggg cgcctcctcc gcgggcatga       420
     ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc gctcctggac       480
     cgccgcggac acggctgcgc agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga       540
     gcagcggaga gcctacctgg agggcgagtg cgtggagtgg ctccgaagat acctggagaa       600
     cgggaaggac aagctggagc gcgctgaccc ccctaagaca cacgtgaccc accaccccat       660
     ctctgaccat gaggccaccc tgaggtgctg ggcccttggt ttctatcctg cggagatcac       720
     actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag       780
     accagcagga gatagaacct tccagaagtc ggcagctgtg gtggtgccat ctggagaaga       840
     gcagagatac acatgccatg tacagcatga ggggctgccg aagccactca ccctgggatg       900
     ggagccgtct tcccagtcca ccgtccccat cgttggcatt gttgctcgcc cggctgtcct       960
     agcagttgtg gtcatcggag ctgtggtcgc tgctgtgatg tgtaggagga agagttcagg      1020
     tggaaaagga gggagctact ctcaagctgc gtgcagcgac agtgcccagg gctctgatgt      1080
     gtctctcaca gcttgaaaag cctgagacag ctgtcttgtg agggactgag atgcaggatt      1140
     tcttcacgcc tcccctttgt gacttcaaga gcctctggac tcttttctgc aaaggcacct      1200
     gaatgtgtct gcgtccctgt tagcataatg tgaggaggtg gagagacagc ccacccttgt      1260
     gtccactgtg acccctgttc ccatgctgac ctgtgtttcc tccccagtca tctttcttgt      1320
     tccagagagg tggggctgga tgtctccatc tctgtctcaa ctttacgtgc actgagctgc      1380
     aacttcttac ttccctactg aaaataagaa tcgaatataa atttgttttc tcaaatattt      1440
     gctatgagag gttgatggat taattaaata agtcaattcc tggaatttga gagagcaaat      1500
     aaagacctga gaaccttcca g                                                1521
//


spacer
spacer