spacer

EBI Dbfetch

ID   AH003070; SV 2; linear; genomic DNA; STD; HUM; 2025 BP.
XX
AC   AH003070; M16007-M16010;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens HLA-A11 class I antigen (AA at 30) (HLA-A) gene, partial cds.
XX
KW   cell surface glycoprotein; surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2025
RX   DOI; 10.1007/BF00404694.
RX   PUBMED; 2437024.
RA   Cowan E.P., Jelachich M.L., Biddison W.E., Coligan J.E.;
RT   "DNA sequence of HLA-A11: remarkable homology with HLA-A3 allows
RT   identification of residues involved in epitopes recognized by antibodies
RT   and T cells";
RL   Immunogenetics 25(4):241-250(1987).
XX
DR   Ensembl-Gn; ENSG00000206503; homo_sapiens.
DR   Ensembl-Tr; ENST00000376809; homo_sapiens.
DR   Ensembl-Tr; ENST00000396634; homo_sapiens.
DR   IMGT/LIGM; AH003070.
XX
CC   On or before Jun 30, 2011 this sequence version replaced gi:184127,
CC   gi:184128, gi:184129, gi:184130, gi:184131.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2025
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..2025
FT                   /gene="HLA-A"
FT   CDS             join(<28..297,462..737,926..1201,1304..1420,1630..1662,
FT                   1805..1852,2022..>2025)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="HLA-A11 class I antigen (AA at 30)"
FT                   /db_xref="GOA:P13746"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1Q94"
FT                   /db_xref="PDB:1QVO"
FT                   /db_xref="PDB:1X7Q"
FT                   /db_xref="PDB:2HN7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13746"
FT                   /protein_id="AAA65449.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTI
FT                   PIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
FT                   "
FT   exon            28..297
FT                   /gene="HLA-A"
FT                   /number=2
FT                   /note="HLA-A11 class I antigen; G00-119-310"
FT   gap             333..432
FT                   /estimated_length=unknown
FT   exon            462..736
FT                   /gene="HLA-A"
FT                   /number=3
FT                   /note="HLA-A11 class I antigen; G00-119-310"
FT   gap             777..876
FT                   /estimated_length=unknown
FT   exon            926..1201
FT                   /gene="HLA-A"
FT                   /number=4
FT                   /note="HLA-A11 class I antigen; G00-119-310; putative"
FT   exon            1304..1420
FT                   /gene="HLA-A"
FT                   /number=5
FT                   /note="HLA-A11 class I antigen; putative"
FT   gap             1469..1568
FT                   /estimated_length=unknown
FT   exon            1630..1662
FT                   /gene="HLA-A"
FT                   /number=6
FT                   /note="HLA-A11 class I antigen; G00-119-310"
FT   exon            1805..1852
FT                   /gene="HLA-A"
FT                   /number=7
FT                   /note="HLA-A11 class I antigen; putative"
FT   exon            2022..>2025
FT                   /gene="HLA-A"
FT                   /number=8
FT                   /note="HLA-A11 class I antigen; putative"
XX
SQ   Sequence 2025 BP; 338 A; 474 C; 563 G; 350 T; 300 other;
     gcaggtctca gccactgctc cccccaggct cccactccat gaggtatttc tacacctccg        60
     tgtcccggcc cggccgcggg gagccccgct tcatcgccgt gggctacgtg gacgacacgc       120
     agttcgtgcg gttcgacagc gacgccgcga gccagaggat ggagccgcgg gcgccgtgga       180
     tagagcagga ggggccggag tattgggacc aggagacacg gaatgtgaag gcccagtcac       240
     agactgaccg agtggacctg gggaccctgc gcggctacta caaccagagc gaggacggtg       300
     agtgaccccg gccccgggcg caggtcacga ccnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nngactgggc tgaccgcggg gtcggggcca ggttctcaca ccatccagat       480
     aatgtatggc tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc       540
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga       600
     catggcagct cagatcacca agcgcaagtg ggaggcggcc catgcggcgg agcagcagag       660
     agcctacctg gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga       720
     gacgctgcag cgcacgggta ccaggggcca ggggcgcctc cctgatcgcc tatagannnn       780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngtcc catgacagat gcaaaatgcc       900
     tgaattttct gactcttccc gtcagacccc cccaagacac atatgaccca ccaccccatc       960
     tctgaccatg aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcaca      1020
     ctgacctggc agcgggatgg ggaggaccag acccaggaca cggagctcgt ggagaccagg      1080
     cctgcagggg atggaacctt ccagaagtgg gcggctgtgg tggtgccttc tggagaggag      1140
     cagagataca cctgccatgt gcagcatgag ggtctgccca agcccctcac cctgagatgg      1200
     ggtaaggagg gagatggggg tgtcatgtct cttagggaaa gcaggagcct ctctggagac      1260
     ctttagcagg gtcagggccc ctcaccttcc cctcttttcc cagagctgtc ttcccagccc      1320
     accatcccca tcgtgggcat cattgctggc ctggttctcc ttggagctgt gatcactgga      1380
     gctgtggtcg ctgccgtgat gtggaggagg aagagctcag gtggagaagg ggtgaagggt      1440
     ggggtctgag atttcttgtc tcactgagnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnct ctaggacctt aaggccctgg ctcctttctg gtatctcaca ggacattttc      1620
     ttcccacaga tagaaaagga gggagttaca ctcaggctgc aagtaagtat gaaggaggct      1680
     gatgcctgag gtccttggga tattgtgttt gggagcccat gggggagctc acccacccca      1740
     caattcctcc tctagccaca tcttctgtgg gatctgacca ggttctgttt ttgttctacc      1800
     ccaggcagtg acagtgccca gggctctgat gtgtctctca cagcttgtaa aggtgagagc      1860
     ttggagggcc tgatgtgtgt tgggtgttgg gcggaacagt ggacacagct gtgctatggg      1920
     gtttctttgc attggatgta ttgagcatgc gatgggctgt ttaaggtgtg acccctcact      1980
     gtgatggata tgaatttgtt catgaatatt tttttctata gtgtg                      2025
//


spacer
spacer