spacer

EBI Dbfetch

ID   M15178; SV 1; linear; mRNA; STD; HUM; 1023 BP.
XX
AC   M15178;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human HLA-DR beta-chain mRNA, partial cds.
XX
KW   antigen; cell surface glycoprotein; class II antigen; glycoprotein;
KW   histocompatibility antigen; major histocompatibility complex;
KW   surface antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1023
RX   DOI; 10.1073/pnas.84.1.209.
RX   PUBMED; 3467350.
RA   Curtsinger J.M., Hilden J.M., Cairns J.S., Bach F.H.;
RT   "Evolutionary and genetic implications of sequence variation in two
RT   nonallelic HLA-DR beta-chain cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 84(1):209-213(1987).
XX
DR   MD5; fda0697dcf966d1ca7cedec398568beb.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000411959; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
DR   H-InvDB; HIT000194381_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1023
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     <1..41
FT                   /note="HLA-DR beta-chain signal peptide"
FT   CDS             <1..743
FT                   /codon_start=3
FT                   /note="HLA-DR beta-chain precursor"
FT                   /db_xref="GOA:P13762"
FT                   /db_xref="H-InvDB:HIT000194381_02.4"
FT                   /db_xref="HGNC:HGNC:4952"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13762"
FT                   /protein_id="AAA35995.1"
FT                   /translation="VLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEE
FT                   YARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRV
FT                   QPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWT
FT                   FQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFL
FT                   GTGLFIYFRNQKGHSGLQPTGLLS"
FT   mat_peptide     42..743
FT                   /note="HLA-DR beta-chain"
XX
SQ   Sequence 1023 BP; 226 A; 272 C; 289 G; 236 T; 0 other;
     cggtgctgag ctccccactg gctttggctg gggacaccca accacgtttc ttggagcagg        60
     ctaagtgtga gtgtcatttc ctcaatggga cggagcgagt gtggaacctg atcagataca       120
     tctataacca agaggagtac gcgcgctaca acagtgacct gggggagtac caggcggtga       180
     cggagctggg gcggcctgac gctgagtact ggaacagcca gaaggacctc ctggagcgga       240
     ggcgggccga ggtggacacc tactgcagat acaactacgg ggttgtggag agcttcacag       300
     tgcagcggcg agtccaacct aaggtgactg tgtatccttc aaagacccag cccctgcagc       360
     accacaacct cctggtctgc tctgtgaatg gtttctatcc aggcagcatt gaagtcaggt       420
     ggttccggaa cggccaggaa gagaaggctg gggtggtgtc cacaggcctg atccagaatg       480
     gagactggac cttccagacc ctggtgatgc tggaaacagt tcctcggagt ggagaggttt       540
     acacctgcca agtggagcat ccaagcatga tgagccctct cacggtgcaa tggagtgcac       600
     ggtctgaatc tgcacagagc aagatgctga gtggagtcgg gggctttgtg ctgggcctgc       660
     tcttccttgg gacagggctg ttcatctact tcaggaatca gaaaggacac tctggacttc       720
     agccaacagg actcttgagc tgaagtgcag atgaccacat tcaaggaaga accttctgcc       780
     ccagctttgc aagatgaaaa gctttcccac ttggctctta ttcttccaca agagctttgt       840
     caggaccagg ttgttactgg ttcagcaact ctgcagaaaa tgtcctccct tgtggcttcc       900
     ttagctcctg ttcttggcct gaagcctcac agctttgatg gcagtgcctc atcttcaact       960
     tttgtgcttc cctttaccta aactgtcctg cctcccgtgc atctgtactc cccttgtgcc      1020
     aca                                                                    1023
//


spacer
spacer