spacer

EBI Dbfetch

ID   M15070; SV 1; linear; mRNA; STD; HUM; 282 BP.
XX
AC   M15070;
XX
DT   23-APR-1990 (Rel. 23, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DR-beta-1 chain mRNA (DR4,Dw15), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RX   DOI; 10.1073/pnas.83.8.2642.
RX   PUBMED; 3458223.
RA   Gregersen P.K., Shen M., Song Q.-L., Merryman P., Degar S., Seki T.,
RA   Maccari J., Goldberg D., Murphy H., Schwenzer J., Wang C.Y.,
RA   Winchester R.J., Nepom G.T., Silver J.;
RT   "Molecular diversity of HLA-DR4 haplotypes";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(8):2642-2646(1986).
XX
DR   MD5; 418b564cd7faaa445b6f5f6697b83d59.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta-1 chain"
FT                   /db_xref="GOA:Q30104"
FT                   /db_xref="H-InvDB:HIT000194376.11"
FT                   /db_xref="IMGT/HLA:DRB1*04:05:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30104"
FT                   /protein_id="AAA59812.1"
FT                   /translation="GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVG
FT                   EYRAVTELGRPSAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 282 BP; 62 A; 71 C; 102 G; 47 T; 0 other;
     ggggacaccc gaccacgttt cttggagcag gttaaacatg agtgtcattt cttcaacggg        60
     acggagcggg tgcggttcct ggacagatac ttctatcacc aagaggagta cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctag cgccgagtac       180
     tggaacagcc agaaggacct cctggagcag aggcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcagcggc ga                          282
//


spacer
spacer