Dbfetch

ID   M15068; SV 1; linear; mRNA; STD; HUM; 282 BP.
XX
AC   M15068;
XX
DT   23-APR-1990 (Rel. 23, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human MHC class II HLA-DR-beta-1 chain mRNA (DR4,Dw10), partial cds.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RX   DOI; 10.1073/pnas.83.8.2642.
RX   PUBMED; 3458223.
RA   Gregersen P.K., Shen M., Song Q.-L., Merryman P., Degar S., Seki T.,
RA   Maccari J., Goldberg D., Murphy H., Schwenzer J., Wang C.Y.,
RA   Winchester R.J., Nepom G.T., Silver J.;
RT   "Molecular diversity of HLA-DR4 haplotypes";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(8):2642-2646(1986).
XX
DR   MD5; b35582332f9442fd6c9f09b96224db3c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /note="MHC HLA-DR-beta-1 chain"
FT                   /db_xref="GOA:Q30103"
FT                   /db_xref="H-InvDB:HIT000194374.11"
FT                   /db_xref="IMGT/HLA:DRB1*04:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30103"
FT                   /protein_id="AAA59811.1"
FT                   /translation="GDTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVG
FT                   EYRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 282 BP; 64 A; 69 C; 101 G; 48 T; 0 other;
     ggggacaccc gaccacgttt cttggagcag gttaaacatg agtgtcattt cttcaacggg        60
     acggagcggg tgcggttcct ggacagatac ttctatcacc aagaggagta cgtgcgcttc       120
     gacagcgacg tgggggagta ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacat cctggaagac gagcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc ga                          282
//