Dbfetch

ID   M14013; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   M14013;
XX
DT   29-NOV-1987 (Rel. 14, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human MHC class I HLA-B27 M+ gene, exons 2-4 (introns unsequenced).
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RX   PUBMED; 3489755.
RA   Coppin H.L., McDevitt H.O.;
RT   "Absence of polymorphism between HLA-B27 genomic exon sequences isolated
RT   from normal donors and ankylosing spondylitis patients";
RL   J. Immunol. 137(7):2168-2172(1986).
XX
DR   MD5; 20510f4f4cb1b751f752b3c4890b2af2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /note="HLA-B27 M2+"
FT                   /db_xref="GOA:P03989"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*27:05:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ROG"
FT                   /db_xref="PDB:1ROH"
FT                   /db_xref="PDB:1ROI"
FT                   /db_xref="PDB:1ROJ"
FT                   /db_xref="PDB:1ROK"
FT                   /db_xref="PDB:1ROL"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /db_xref="PDB:5DEF"
FT                   /db_xref="PDB:5DEG"
FT                   /db_xref="PDB:5IB1"
FT                   /db_xref="PDB:5IB2"
FT                   /db_xref="PDB:5IB3"
FT                   /db_xref="PDB:5IB4"
FT                   /db_xref="PDB:5IB5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03989"
FT                   /protein_id="AAA59643.1"
FT                   /translation="GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPRE
FT                   EPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVG
FT                   PDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGE
FT                   CVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGE
FT                   DQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 822 BP; 176 A; 256 C; 277 G; 113 T; 0 other;
     ggctcccact ccatgaggta tttccacacc tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatca ccgtgggcta cgtggacgac acgctgttcg tgaggttcga cagcgacgcc       120
     gcgagtccga gagaggagcc gcgggcgccg tggatagagc aggaggggcc ggagtattgg       180
     gaccgggaga cacagatctg caaggccaag gcacagactg accgagagga cctgcggacc       240
     ctgctccgct actacaacca gagcgaggcc gggtctcaca ccctccagaa tatgtatggc       300
     tgcgacgtgg ggccggacgg gcgcctcctc cgcgggtacc accaggacgc ctacgacggc       360
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgccgcgga cacggcggct       420
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag agcctacctg       480
     gagggcgagt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       540
     cgcgcggacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc       600
     ctgaggtgct gggccctggg cttctaccct gcggagatca cactgacctg gcagcgggat       660
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc       720
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat       780
     gtacagcatg aggggctgcc gaagcccctc accctgagat gg                          822
//