spacer

EBI Dbfetch

ID   M13279; SV 1; linear; mRNA; STD; HUM; 282 BP.
XX
AC   M13279;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC HLA-DR4 DQ-beta chain first variable domain mRNA, clone KT3c21.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-282
RX   DOI; 10.1073/pnas.83.8.2642.
RX   PUBMED; 3458223.
RA   Gregersen P.K., Shen M., Song Q.-L., Merryman P., Degar S., Seki T.,
RA   Maccari J., Goldberg D., Murphy H., Schwenzer J., Wang C.Y.,
RA   Winchester R.J., Nepom G.T., Silver J.;
RT   "Molecular diversity of HLA-DR4 haplotypes";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(8):2642-2646(1986).
XX
DR   MD5; e73d50195af098eab604c40d1085c1fd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>282
FT                   /codon_start=1
FT                   /gene="HLA-DRB4"
FT                   /note="MHC HLA-DRQ-beta chain"
FT                   /db_xref="GOA:Q30146"
FT                   /db_xref="IMGT/HLA:DQB1*04:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30146"
FT                   /protein_id="AAA59807.1"
FT                   /translation="RDSPEDFVFQFKGMCYFTNGTELVRGVTRYIYNREEYARFDSDVG
FT                   VYRAVTPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRR"
XX
SQ   Sequence 282 BP; 61 A; 74 C; 97 G; 50 T; 0 other;
     agagactctc ccgaggattt cgtgttccag tttaagggca tgtgctactt caccaacggg        60
     accgagctcg tgcggggtgt gaccagatac atctataacc gagaggagta cgcgcgcttc       120
     gacagcgacg tgggggtgta tcgggcggtg acgccgctgg ggcggcttga cgccgagtac       180
     tggaatagcc agaaggacat cctggaggag gaccgggcgt cggtggacac cgtatgcaga       240
     cacaactacc agttggagct ccgcacgacc ttgcagcggc ga                          282
//


spacer
spacer