spacer

EBI Dbfetch

ID   M12967; SV 1; linear; genomic DNA; STD; HUM; 4016 BP.
XX
AC   M12967;
XX
DT   26-JUL-1991 (Rel. 28, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class I HLA-B27 cell membrane glycoprotein gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4016
RX   PUBMED; 3912316.
RA   Weiss E.H., Kuon W., Doerner C., Lang M., Riethmueller G.;
RT   "Organization, sequence and expression of the HLA-B27 gene: a molecular
RT   approach to analyze HLA and disease associations";
RL   Immunobiology 170(5):367-380(1985).
XX
DR   MD5; 93868b8e717f6ba5bed5a4c6c9ea46f1.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
DR   EuropePMC; PMC54286; 2164225.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4016
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   prim_transcript 517..3785
FT                   /note="HLA-b27 mRNA and introns"
FT   CDS             join(518..590,720..989,1232..1507,2083..2358,2451..2567,
FT                   3010..3042,3149..3192)
FT                   /codon_start=1
FT                   /note="human lymphocyte antigen-b27 (HLA-b27)"
FT                   /db_xref="GOA:P03989"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*27:05:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="PDB:1HSA"
FT                   /db_xref="PDB:1JGD"
FT                   /db_xref="PDB:1JGE"
FT                   /db_xref="PDB:1K5N"
FT                   /db_xref="PDB:1OF2"
FT                   /db_xref="PDB:1OGT"
FT                   /db_xref="PDB:1ROG"
FT                   /db_xref="PDB:1ROH"
FT                   /db_xref="PDB:1ROI"
FT                   /db_xref="PDB:1ROJ"
FT                   /db_xref="PDB:1ROK"
FT                   /db_xref="PDB:1ROL"
FT                   /db_xref="PDB:1UXS"
FT                   /db_xref="PDB:1UXW"
FT                   /db_xref="PDB:1W0V"
FT                   /db_xref="PDB:1W0W"
FT                   /db_xref="PDB:2A83"
FT                   /db_xref="PDB:2BSR"
FT                   /db_xref="PDB:2BSS"
FT                   /db_xref="PDB:2BST"
FT                   /db_xref="PDB:3B3I"
FT                   /db_xref="PDB:3B6S"
FT                   /db_xref="PDB:3BP4"
FT                   /db_xref="PDB:3BP7"
FT                   /db_xref="PDB:3CZF"
FT                   /db_xref="PDB:3D18"
FT                   /db_xref="PDB:3DTX"
FT                   /db_xref="PDB:3HCV"
FT                   /db_xref="PDB:3LV3"
FT                   /db_xref="PDB:4G8G"
FT                   /db_xref="PDB:4G8I"
FT                   /db_xref="PDB:4G9D"
FT                   /db_xref="PDB:4G9F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P03989"
FT                   /protein_id="AAA36221.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRT
FT                   LLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            <518..590
FT                   /number=1
FT                   /note="human lymphocyte antigen-b27 (HLA-b27)"
FT   intron          591..719
FT                   /note="HLA-b27, intron A"
FT   exon            720..989
FT                   /number=2
FT                   /note="human lymphocyte antigen-b27"
FT   intron          990..1231
FT                   /note="HLA-b27, intron B"
FT   exon            1232..1507
FT                   /number=3
FT                   /note="human lymphocyte antigen-b27"
FT   intron          1508..2082
FT                   /note="HLA-b27, intron C"
FT   exon            2083..2358
FT                   /number=4
FT                   /note="human lymphocyte antigen-b27"
FT   intron          2359..2450
FT                   /note="HLA-b27, intron D"
FT   exon            2451..2567
FT                   /number=5
FT                   /note="human lymphocyte antigen-b27"
FT   intron          2568..3009
FT                   /note="HLA-b27, intron E"
FT   exon            3010..3042
FT                   /number=6
FT                   /note="human lymphocyte antigen-b27"
FT   intron          3043..3148
FT                   /note="HLA-b27, intron F"
FT   exon            3149..>3192
FT                   /number=7
FT                   /note="human lymphocyte antigen-b27"
XX
SQ   Sequence 4016 BP; 769 A; 1115 C; 1252 G; 878 T; 2 other;
     gagctcactc tctggcatca agttctccgt gatcagtttc cctacacaag atccaagagg        60
     agaggtaagg agtgagaggc agggagtcca gttcagggac agggattcca ggaggagaag       120
     tgaaggggaa gcgggtgggc gccactgggg gtctctccct ggtttccaca gacagatcct       180
     tgtgccggac tcaggcagac agtgtgacaa agaggctggt gtaggagaag agggatcagg       240
     acgaacgtcc aaggccccgg gcgcggtctc agggtctcag gctccgagag ccttgtctgc       300
     attggggagg cgcacagttg gggattcccc actcccacga gtttcacttc ttctcccaac       360
     ctatgtcggg tccttcttcc aggatactcg tgacgcgtcc ccatttccca ctcccattgg       420
     gtgtcgggtg tctagagaag ccaatcagtg tcgccggggt cccagttcta aagtccccac       480
     gcacccaccc ggactcagaa tctcctcaga cgccgagatg cgggtcacgg cgccccgaac       540
     cctcctcctg ctgctctggg gggcagtggc cctgaccgag acctgggctg gtgagtgcgg       600
     ggtcaggcag ggaaatggcc tctgtgggga ggagcgaggg gacgcaggcg ggggcgcagg       660
     acccggggag ccgcgccggg aggagggtcg ggcgggtctc agcccctcct cgcccccagg       720
     ctcccactcc atgaggtatt tccacacctc cgtgtcccgg cccggccgcg gggagccccg       780
     cttcatcacc gtgggctacg tggacgacac gctgttcgtg aggttcgaca gcgacgccgc       840
     gagtccgaga gaggagccgc gggcgccgtg gatagagcag gaggggccgg agtattggga       900
     ccgggagaca cagatctgca aggccaaggc acagactgac cgagaggacc tgcggaccct       960
     gctccgctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggc gcaggtcacg      1020
     actccccatc ccccacgtac ggcccgggtc gccccgagtc tccgggtccg agatccgccc      1080
     ccgaggccgc gggacccgcc cagaccctcg accggcgaga gcccaggcgc gtttacccgg      1140
     tttcattttc agttgaggcc aaaatccccg cggttggtcg gggcggggcg gggctcgggg      1200
     gdgacggggc tgaccgcggg ggcgggtcca gggtctcaca ccctccagaa tatgtatggc      1260
     tgcgacgtgg ggccggacgg gcgcctcctc cgcgggtacc accaggacgc ctacgacggc      1320
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgccgcgga cacggcggct      1380
     cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag agcctacctg      1440
     gagggcgagt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag      1500
     cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg ccggggatgg      1560
     cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct cccttgaatg      1620
     gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct ctaggacaat      1680
     taagggatga cgtctctgag gaaatggagg ggaagacagt ccctagaata ctgatcaggg      1740
     gtcccctttg acccctgcag cagccttggg aaccgtgact tttcctctca ggccttgttc      1800
     tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt cactttacct      1860
     ccactcagat caggagcaga agtccctgtt ccccgctcag agactcgaac tttccaatga      1920
     ataggagatt atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt gccccttccc      1980
     caccccaggt gtcctgtcca ttctcaggct ggtcacatgg gtggtcctag ggtgtcccat      2040
     gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca aagacacacg      2100
     tgacccacca ccccatctct gaccatgagg ccaccctgag gtgctgggcc ctgggcttct      2160
     accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact caggacactg      2220
     agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca gctgtggtgg      2280
     tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg ctgccgaagc      2340
     ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc tcagggaaag      2400
     caggagccct tcagcaggtc agggcccctc atcttccctt cctttcccag agccgtcttc      2460
     ccagtccacc gtccccatcg tgggcattgt tgctggcctg gctgtcctag cagttgtggt      2520
     catcggagct gtggtcgctg ctgtgatgtg taggaggaag agctcaggta gggaaggggt      2580
     gaggggtggg gtctgagttt tcttgtccca ctgggggttt caagccccag gtagaagtgt      2640
     tccctgcctc attactggga agcagcatcc acacaggggc taacgcagcc tgggaccctg      2700
     tgtgccagca cttactcttt tgtgcagcac atgtgacaat gaaggacgga tgtatcacct      2760
     tggtggttgt ggtgttgggg tcctgattcc agcattcatg agtcagggga aggtccctgc      2820
     taaggacaga ccttaggagg gcagttggtc caggacccac acttgctttc ctcgtgtttc      2880
     ctgatcctgc cttgggtctg tagtcatact tctggaaatt ccttttgggt ccaagacgag      2940
     gaggttcctc taagatctca tggccctgct tcctcccagt cccctcacag ggaaattttc      3000
     ttcccacagg tggaaaagga gggagctact ctcaggctgc gtgtaagtga tgggggtggg      3060
     agtgtggagg agctcaccca ccccctaatt cctcctgtcc cacgtctcct gcgggctctg      3120
     accaggtcct gtttttgttc tactccaggc agcgacagtg cccagggctc tgatgtgtct      3180
     ctcacagctt gaaaaggtga gattcttggg gtctagagtg ggtggggtgg caggtctggg      3240
     ggtgggtggg gcagtgggga aaggcctggg taatggagat tctttgattg ggatgtttcg      3300
     cgtgtgtggt gggctgttta gactgtcatc acttaccatg actaaccaga atttgttcat      3360
     gactgttgtt ttctgtagcc tgagacagct gtcttgtgag ggactgagat gcaggatttc      3420
     ttcacgcctc ccctttgtga cttcaagagc ctctggcatc tctttctgca aaggcacctg      3480
     aatgtgtctg cgtccctgtt agcataatgt gaggaggtgg agagaccadc ccacccccgt      3540
     gtccactgtg acccctgttc ccatgctgac ctgtgtttcc tccccagtca tctttcctgt      3600
     tccagagagg tggggctgga tgtctccatc tctgtctcaa ctttatgtgc actgagctgc      3660
     aacttcttac ttcgctactg aaaataagaa tctgaatata aatttgtttt ctcaaatatt      3720
     tgctatgaga ggttgatgga ttaattaaat aagtcaattc ctggaatttg agagagcaaa      3780
     taaagacctg agaaccttcc agaatctgca tgttcgctgt gctgagtctg ttgcaggtgg      3840
     ggtgtgcaga aggctgtggg gggccgagtg tggacgggcc tgtgcccatt tggtgttgag      3900
     tccatcatgg gctttatgtg gttagtcctc agctgggtca ccttcactgc tccattgtcc      3960
     ttgtcccttc agtggaaacg ttgtccagcg ggagctgtga ccacagaggc tcacac          4016
//


spacer
spacer