Dbfetch

ID   M12678; SV 1; linear; mRNA; STD; HUM; 1507 BP.
XX
AC   M12678;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Human HLA-B27 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1507
RX   DOI; 10.1073/pnas.83.5.1428.
RX   PUBMED; 3485286.
RA   Szots H., Riethmuller G., Weiss E., Meo T.;
RT   "Complete sequence of HLA-B27 cDNA identified through the characterization
RT   of structural markers unique to the HLA-A, -B, and -C allelic series";
RL   Proc. Natl. Acad. Sci. U.S.A. 83(5):1428-1432(1986).
XX
DR   MD5; f234f09c2c11ebaec5c3e2b159a59fed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1507
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>1507
FT                   /note="HLA-B27 mRNA"
FT   CDS             <1..1080
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /note="HLA-B27 peptide"
FT                   /db_xref="GOA:Q29934"
FT                   /db_xref="H-InvDB:HIT000194173.9"
FT                   /db_xref="IMGT/HLA:B*27:05:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q29934"
FT                   /protein_id="AAA59614.1"
FT                   /translation="TAPETLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPRFIT
FT                   VGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLR
FT                   YYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQI
FT                   TQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRVDPPKTHVTHHPISDHEATL
FT                   RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGS
FT                   YSQAACSDSAQGSDVSLTA"
XX
SQ   Sequence 1507 BP; 318 A; 433 C; 459 G; 297 T; 0 other;
     acggcgcccg agaccctcct cctgctgctc tggggggcag tggccctgac cgagacctgg        60
     gctggctccc actccatgag gtatttccac acctccgtgt cccggcccgg ccgcggggag       120
     ccccgcttca tcaccgtggg ctacgtggac gacacgctgt tcgtgaggtt cgacagcgac       180
     gccgcgagtc cgagagagga gccgcgggcg ccgtggatag agcaggaggg gccggagtat       240
     tgggaccggg agacacagat ctgcaaggcc aaggcacaga ctgaccgaga ggacctgcgg       300
     accctgctcc gctactacaa ccagagcgag gccgggtctc acaccctcca gaatatgtat       360
     ggctgcgacg tggggccgga cgggcgcctc ctccgcgggt accaccagga cgcctacgac       420
     ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgccgc ggacacggcg       480
     gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct gagagcctac       540
     ctggagggcg agtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg       600
     cagcgcgtgg accccccaaa gacacacgtg acccaccacc ccatctctga ccatgaggcc       660
     accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg       720
     gatggcgagg accaaactca ggacactgag cttgtggaga ccagaccagc aggagataga       780
     accttccaga agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc       840
     catgtacagc atgaggggct gccgaagccc ctcaccctga gatgggagcc gtcttcccag       900
     tccaccgtcc ccatcgtggg cattgttgct ggcctggctg tcctagcagt tgtggtcatc       960
     ggagctgtgg tcgctgctgt gatgtgtagg aggaagagct caggtggaaa aggagggagc      1020
     tactctcagg ctgcgtgcag cgacagtgcc cagggctctg atgtgtctct cacagcttga      1080
     aaagcctgag acagctgtct tgtgagggac tgagatgcag gatttcttca cgcctcccct      1140
     ttgtgacttc aagagcctct ggcatctctt tctgcaaagg cacctgaatg tgtctgcgtc      1200
     cctgttagca taatgtgagg aggtggagag accagcccac ccccgtgtcc actgtgaccc      1260
     ctgttcccat gctgacctgt gtttcctccc cagtcatctt tcctgttcca gagaggtggg      1320
     gctggatgtc tccatctctg tctcaacttt atgtgcactg agctgcaact tcttacttcc      1380
     ctactgaaaa taagaatcga atataaattt gttttctcaa atatttgcta tgagaggttg      1440
     atggattaat taaataagtc aattcctgga atttgagaga gcaaataaag acctgagaac      1500
     cttccag                                                                1507
//