Dbfetch

ID   M11799; SV 1; linear; genomic DNA; STD; HUM; 3520 BP.
XX
AC   M11799;
XX
DT   16-JUL-1988 (Rel. 16, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 10)
XX
DE   Human MHC class I HLA-Bw58 gene, complete cds.
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3520
RX   PUBMED; 2995352.
RA   Ways J.P., Coppin H.L., Parham P.;
RT   "The complete primary structure of HLA-Bw58";
RL   J Biol Chem 260(22):11924-11933(1985).
XX
DR   MD5; f35442168fd6be031f05bbd5577059a7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3520
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   prim_transcript 67..3386
FT                   /note="HLA-Bw58 of MHC, mRNA and introns"
FT   exon            <88..160
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="HLA-Bw58 of MHC; G00-120-048"
FT   CDS             join(88..160,290..559,806..1081,1657..1932,2037..2153,
FT                   2595..2627,2734..2777)
FT                   /partial
FT                   /codon_start=1
FT                   /note="HLA-Bw58 of MHC"
FT                   /db_xref="GOA:P10319"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*58:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10319"
FT                   /protein_id="AAA59628.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   intron          161..289
FT                   /note="HLA-Bw58 intron A"
FT   exon            290..559
FT                   /number=2
FT   intron          560..805
FT                   /note="HLA-Bw58 intron B"
FT   exon            806..1081
FT                   /number=3
FT   intron          1082..1656
FT                   /note="HLA-Bw58 intron C"
FT   exon            1657..1932
FT                   /number=4
FT   intron          1933..2036
FT                   /note="HLA-Bw58 intron D"
FT   exon            2037..2153
FT                   /number=5
FT   intron          2154..2594
FT                   /note="HLA-Bw58 intron E"
FT   exon            2595..2627
FT                   /number=6
FT   intron          2628..2733
FT                   /note="HLA-Bw58 intron F"
FT   exon            2734..>2777
FT                   /number=7
FT                   /note="HLA-Bw58 of MHC"
XX
SQ   Sequence 3520 BP; 665 A; 981 C; 1099 G; 775 T; 0 other;
     tctagagaag ccaatcagtg tcgccggggt cccagttcta aagtccccac gcacccaccc        60
     ggactcagaa tctcctcaga cgccgagatg cgggtcacgg cgccccgaac cgtcctcctg       120
     ctgctctggg gggcagtggc cctgaccgag acctgggccg gtgagtgcgg ggtcgggagg       180
     gaaatggcct ctgtggggag gagcgagggg accgcaggcg ggggcgcagg acctgaggag       240
     ccgcgccggg aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc       300
     atgaggtatt tctacaccgc catgtcccgg cccggccgcg gggagccccg cttcatcgca       360
     gtgggctacg tggacgacac ccagttcgtg aggttcgaca gcgacgccgc gagtccgagg       420
     acggagcccc gggcgccatg gatagagcag gaggggccgg agtattggga cggggagaca       480
     cggaacatga aggcctccgc gcagacttac cgagagaacc tgcggatcgc gctccgctac       540
     tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gactccccat       600
     cccccacgta cggcccgggg tcgccccgag tctccgggtc cgagatccgc ctccctgagg       660
     ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta cccggtttca       720
     ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc tcgggggacg       780
     gggctgaccg cggggccggg gccagggtct cacatcatcc agaggatgta tggctgcgac       840
     ctggggcccg acgggcgcct cctccgcggg catgaccagt ccgcctacga cggcaaggat       900
     tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc ggctcagatc       960
     acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta cctggagggc      1020
     ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg      1080
     ggtaccaggg gcagtgggga gccttcccca tctcctatag gtcgccgggg atggcctccc      1140
     acgagaagag gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg aatggagaat      1200
     ggcatgagtt ttcctgagtt tcctctgagg gccccctctt ctctctagga caattaaggg      1260
     atgacgtctc tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcccc      1320
     tttgacccct gcagcagcct tgggaaccgt gacttttcct ctcaggcctt gttctctgcc      1380
     tcacactcag tgtgtttggg gctctgattc cagcacttct gagtcacttt acctccactc      1440
     agatcaggag cagaagtccc tgttccccgc tcagagactc gaactttcca atgaatagga      1500
     gattatccca ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacacc      1560
     aggtgtcctg tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga      1620
     tgcaaagcgc ctgaattttc tgactcttcc catcagaccc cccaaagaca cacgtgaccc      1680
     accaccccgt ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg      1740
     cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg      1800
     tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt      1860
     ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca      1920
     ccctgagatg gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag      1980
     cccttctgga gcccttcagc agggtcaggg cccctcgtct tcccctcctt tcccagagcc      2040
     atcttcccag tccaccatcc ccatcgtggg cattgttgct ggcctggctg tcctagcagt      2100
     tgtggtcatc ggagctgtgg tcgctactgt gatgtgtagg aggaagagct caggtaggga      2160
     aggggtgagg ggtggggtct gggttttctt gtcccactgg gggtttcaag ccccaggtag      2220
     aagtgttccc tccctcatta ctgggaagca gcatccacac aggggctaac gcagcctggg      2280
     accctgtgtg ccagcactta ctcttttgtg cagcacatgt gacaatgaag gacggatgta      2340
     tcaccttgat ggttgtggtg ttggggtcct gatttcagca ttcatgagtc aggggaaggt      2400
     ccctgctaag gacagacctt aggagggcag ttggtccagg acccacactt gctttcctcg      2460
     tgtttcctga tcctgccttg ggtctgtagt catacttctg gaaattcctt ttgggtccaa      2520
     gacgaggagg ttcctctaag atcttaaggc cctgcttcct cccagtcccc tcacaggaca      2580
     ttttcttccc acaggtggaa aaggagggag ctactctcag gctgcgtgta agtggtgggg      2640
     gtgggagtgt ggaggagctc acccacccca taattcctcc tgtcccacgt ctcctgcggg      2700
     ctctgaccag gtcctgtttt tgttctactc cagccagcga cagtgcccag ggctctgatg      2760
     tgtctctcac agcttgaaaa ggtgagattc ttggggtcta gagtgggtcg ggtggcgggt      2820
     ctgggggtgg gtggggcaga ggggaaaggc ctgggtaatg gggattcttt gattgggatg      2880
     tttcgcgtgt gtggtgggct gtttacagtg tcatcgctta ccatgactaa ccagaatttg      2940
     ttcatgactg ttgttttctg tagcctgaga cagctgtctt gtgagggact gagatgcagg      3000
     atttcttcac gcctcccctt tgtgacttca agagcctctg gcatctcttt ctgcaaaggc      3060
     acctgaatgt gtctgcgtcc ctgttagcat aatgtgagga ggtggagaca cagcccaccc      3120
     ttgtgtccac tgtgacccct gttcccatgc tgacctgtgt ttcctcccca gtcatctttc      3180
     ctgttccaga gaggtggggc tggatgtctc catctctgtc tcaactttac gtgcactgag      3240
     ctgcaacttc ttacttccct actgaaaata agaatctgaa tataaatttg ttttctcaaa      3300
     tatttgctat gagaggttga tggattaatt aaataagtca attcctggaa tttgagagag      3360
     caaataaaga cctgagaacc ttccagaatc tgcatgttcg ctgtgctgag tctgttgcag      3420
     gtggggtgtg gagaaggctg tggggggccg agtgtggacg gggcctgtgc ccatttggtg      3480
     ttgagtccat catgggcttt atgtggttag tcctcagctg                            3520
//