Dbfetch

ID   LT904700; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   LT904700;
XX
PR   Project:PRJEB21989;
XX
DT   02-OCT-2017 (Rel. 134, Created)
DT   02-OCT-2017 (Rel. 134, Last updated, Version 1)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, allele
DE   HLA-DRB1 *03,15new, exon 2
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RA   Yang E., Li T.;
RT   ;
RL   Submitted (31-JUL-2017) to the INSDC.
RL   TZUCHI, Buddhist Tzu Chi General Hospital, Tzu Chi Stem Cells Center, 707
RL   Section 3 Chung Yang Road, Hualien 970, Taiwan
XX
DR   MD5; 80ff5768fa528fcfc254488a8d282fbe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1 *03,15new"
FT                   /number=2
FT   CDS             <3..>270
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1 *03,15new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A2C8CYP6"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2C8CYP6"
FT                   /protein_id="SNU32340.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 55 A; 66 C; 101 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//