Dbfetch

ID   LT883484; SV 2; linear; genomic DNA; STD; HUM; 11512 BP.
XX
AC   LT883484;
XX
DT   11-JUN-2017 (Rel. 133, Created)
DT   15-AUG-2017 (Rel. 133, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1758, allele HLA-DPB1*535:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11512
RA   Albrecht V.;
RT   ;
RL   Submitted (08-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RA   Albrecht V., Zweiniger C., Boehme I., Schmidt A.H.;
RT   "Characterisation and Confirmation of new HLA alleles found by DKMS Life
RT   Science Lab";
RL   Unpublished.
XX
DR   MD5; 84e0db45ec1db2be7bbab6442bc5539f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11512
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1758"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=1
FT   CDS             join(367..466,5001..5264,9261..9542,10090..10200,
FT                   10530..10549)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1C3PI46"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C3PI46"
FT                   /protein_id="SMZ62526.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPEAEYWNSQKDILEEERAVPDR
FT                   ICRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVGSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5000
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=1
FT   exon            5001..5264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=2
FT   intron          5265..9260
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=2
FT   exon            9261..9542
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=3
FT   intron          9543..10089
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=3
FT   exon            10090..10200
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=4
FT   intron          10201..10529
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=4
FT   exon            10530..11512
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*535:new"
FT                   /number=5
XX
SQ   Sequence 11512 BP; 3124 A; 2539 C; 2995 G; 2854 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaatatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgagct       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     gaaaatggga ccaagaggtc caggataacc ttggacagac aaggtttgca gagagagaag       780
     ttggcaagtg caggctcctg ggcgtgttca catctgcatc cagcctggag gggactcagg       840
     cagagagccc taagctggag tgtccaggct ctgaggatca ctgaggattc agtgctcacg       900
     aagaatgcct cttattcccc agggtggagc aggagcccac accccttgga caattaagga       960
     gagaagggag ggagggggat aggttttagc ccctgaaggc attctcatta aaggtacttc      1020
     tcccagcctc cccagaactt ggttagggta ctagagtggg ttgcgacttg taggaagaat      1080
     gagatgaggt tgtgtgggtg catgacaggg attgagtgta ggttatcaga cagccaagga      1140
     agcagtaacc aagtgaaaaa tctcttcttc ctgctgcctc cctgtggctg gtgtaatatt      1200
     atggcatcta tgatccattg tttttctctc aggatactct caggatattt ctttttatat      1260
     atatatatac tttaagttct agggtacatg tgcacaacgt gcaggtttgt tacatatgta      1320
     tacatgtgcc atgttggtgt gctgcaccca ttaactcgtc atttacatta ggtatatttc      1380
     ctaatgctat ccctcccccc tccccccacc ccacaacagg ccccggtgta tgatgttccc      1440
     cttcctgtgt ccatgtgttc tcattgttca gttcccacct atgagtgaga acatgtggtc      1500
     tttggttttt tgtccttgca atagtttgct gtgaatgatg gtttccagct tcctccatgt      1560
     ccctacaaag gacatgaact catccttttt tatggctgca cagtattcca tggtgtatat      1620
     gtgtgcattt tcttaatcca gtctatcact gatggacagt tgggttggtt ccaagtcttt      1680
     gctattgtga atagtgccgc tataaacata tgtgtgcatg tgtctttata gcagcatgat      1740
     ttataatcct ttgggtatat acccagtaat gggatggctg ggtcaaatgg tatttctagt      1800
     tctagatcct tgaggaattg ccacaatgtc ttgagatacc atctcacacc agttaaaatg      1860
     gcgatcatta aaaagtcagg aaacaacagg tgctggagag gatgtggaga aataggaaca      1920
     cttttactct gttggtggga ctgtaaacta gttcaaccat tgtactctca ggacatttct      1980
     agtccaaatt tacaccaaca ctctgagagg aaggactgca aagtaggtac cttagttttc      2040
     cactgacttc cacttttcct gcttacaccc ttcctcctag acccctccac acccctccta      2100
     ggacacacct agaaggtact gacatcatgt cacctcctca tctttcaggg tagcaaggtt      2160
     ggaatctcct gaatacagcc cctcaagccc taaaacctct tatctattac ctcgggttca      2220
     tgtccaggaa ggggaggaga acttgaactt atagtcacag aagggtgctg agaactaacc      2280
     agcaggacgg ctcagccctg ggaactgcag aggggtgagg ctggggagag aggaggctgg      2340
     agcagcactg gtgacactga acagtgtcag gaggaggtga cggatgcagc gcccccatcc      2400
     cataggcaga gctgtcatgt gggatgaggg acagtgttgg gagtcaccga ggaaacccag      2460
     aggtggggga gcagagagca gaagggggca tgtgatgctg gacagtgaaa gggaggacgg      2520
     gcaaaggctg ggttgaggtt tgtaggggga atgagatgag gcagtggagc catgtgacag      2580
     ggactgaggg tagattactg gagctccctg cgtagaatga atgttcaatc aaaacctgct      2640
     ggagggagag ctggagccat aggggagtgg gtaaagtggg cagggctgat tccacaattc      2700
     cctgcatgct cccccaactc cacacacatc cccaacctca aacagggcac aagaccaaag      2760
     ggctgaggag ccaggctata gcttaaagag gctgggggag aaaagcttgg ctgagacaac      2820
     ccatagggag ctagaggttt ttaatatatc ctattctgaa taagagacga attcattcag      2880
     atcagtggtt tcaaaccgtg ctctgggcaa ctcaattgct aagggttcca caaacaggat      2940
     aaagtttctt atatacaaaa aaaatgaagg tttcaaatta caccataaag cccctcattg      3000
     cttatgtcta cttggcaggt aaaattccat ttcaaaagtt aaatgtactt aaaaaattac      3060
     ctaagactgg gtaaattaaa aaaattaaac gttgcaaaga aaaaattcaa aattcttatt      3120
     cttgaatgaa aaacgttctc ttactggtga ttgaggagga gaaacaaaga ctaacaaatg      3180
     aaaatgggag aatccacact cagagtgggg caattgaaca ggcaggggcg gatggatggc      3240
     agaggaggag gaatctggac tcaaggagct ggggggctct gggcctggaa ttttagggtc      3300
     tggggcccaa ggcaccagga gaagaggcag gtcaggatat ctgagtcaag acctgggatc      3360
     ttgccttagc aatgacactg gagactaaag gtggactcca tggtgccctt gagcccagcc      3420
     ctaccccatc tccactatcc tctgccacca gctgtgcaac ttctgctagg ggtgaggtta      3480
     ataaactgga gaagttaatt tgtggagcat gaaacagatg agcagaacaa tcacagcacc      3540
     ttaatttccc cagtgtgccc aagaacagag caggcctgaa gatactcaaa cagaaacaaa      3600
     catgtgccgt gtcactgata attctgtgta gacacacacc tgccagacac tgctcatggc      3660
     actccctagg aagaacagca tgtgggaaag gctgccaaaa ttgttcatgt aaaaattaca      3720
     tcaatgctgt cttcctcggt gctgcctatg cagctggcag ccatctcttc ctccacatca      3780
     tggcctccct cagactcctc atgaaggata agatcctcaa aaagaggacc aacaagttca      3840
     tgaggcacca atcagactga aatgtcaaaa ttaagcataa ctggcggaaa cccagaggtc      3900
     ttaacagtag ggttcgtaga aggtccaagg gccagatctt gatgcccaac attgcttatg      3960
     ggagcaacaa caacaacaaa aaacacatgc tgcccagtgg cttccagaag tttctggtcc      4020
     acagcctcaa ggagctgaaa gtgctgctga tgtgcaacaa atcttactgt gctgagatcg      4080
     ctcacaaaat ttcctccaga actgcaaagt catcatggaa agagtcaccc agccggccat      4140
     cagagtcacc aaccccagta ccagggtgca cagctaagaa aatgagtaga aagttcacgt      4200
     ccacgttttg tgtgtaaata aaaccataaa aactgccaaa aaaaattaca tcaatgcctc      4260
     taaacccaaa ggactctacc cccacaggtc cctggttgtt gtggtgattt tcattgtgta      4320
     aaatactttc cacatctttt gacaccaagt ctttctgcag ccatgtttga aaattaactt      4380
     tcaggctaca gagtctttct tataccaaag ttgaagaaag ttttaagaaa tatatttcta      4440
     catctcctaa atgcaaaaca acaggagcaa gttgaggaat tctcaagaaa ctggtcgaga      4500
     agagagagcg cttagctatg gaaaagagaa agaaggaagg gagggcttcc tggaggaggt      4560
     ggcatttgaa ccaggactga catcaggatg gaaatgtcag tcagggagtt aagtaggggg      4620
     agcagctccg ccctccacgt ccccagctcc tcccgcccct gttttttctc ccagtgaccc      4680
     cacgtgaaac gtctccgcct cctccagcca ccagcagaag ggactgcctt cccttcagtg      4740
     ctcgcccctc cctagtgatc actcagtgcc cctgagctca ttcttttcag taaattctct      4800
     ctctgcgtgg tgagaaaaca ggcctggaga ggctctgcga cccgcttagg accacagaac      4860
     tcggtactag gaaaactcct attttaaaat ccagccctgg gtgggaagat ttgggaagaa      4920
     tcgttaatat tgagagagag agggagaaag aggattagat gagagtggcg cctccgctca      4980
     tgtccgcccc ctccccgcag agaattacct tttccaggga cggcaggaat gctacgcgtt      5040
     taatgggaca cagcgcttcc tggagagata catctacaac cgggaggagt tcgtgcgctt      5100
     cgacagcgac gtgggggagt tccgggcggt gacggagctg gggcggcctg aggcggagta      5160
     ctggaacagc cagaaggaca tcctggagga ggagcgggca gtgccggaca ggatatgcag      5220
     acacaactac gagctggacg aggccgtgac cctgcagcgc cgaggtgagt gagggctttg      5280
     ggccggcggt cccagggcag ccccgcgggc ccgtgcccag ggcgcaggag cagccgggtt      5340
     ggcctaaggg accttagtgc cgggcggaaa ggggactttg ggttggggat tcatgggggg      5400
     agcccatctg gagcttgtca ggggagcgag cgcggggacc tggactgggc tgagcatgga      5460
     gtgaggagga cgggagcaga gagacccccg ggacttcatc aggcctggca gctgactgca      5520
     tgtggggtga gaaaaggaag ccacaggaca gcgcacaagg gtgtggtgtg gagatggagg      5580
     tggagatggc acagcaggcc acacagagaa gaaacctaca gggaggtagc tgggtttgag      5640
     gtgcttgagg ggcagatggg tggtctgatg ggcaggtaga cagaagggtc tgcagccgag      5700
     gaggagactg agatacatga gaccatccag ggagagggga cccaggggga agagcaaagg      5760
     accggatcct gggaactgga cagttgtgat ttggccaaga cagaaaagcc tgtgaaagag      5820
     accaaaaaaa cccaagtgcg gtgtgaggag aggcccgcag agaagagtct tggaagctga      5880
     ggggaggtga cctcagcagc acagtggaca gcggtgccag tgacttggga aggtcagaaa      5940
     acagaagatg gaaagtgggt ttggaaacca gggagacctg gggagagcag gttggccgca      6000
     gcggcaggag ctggaatggg agggggtgca tgaggctgag tgtggcgcat cctcctcggg      6060
     gctgagatgg attttacttg tcttgggttc cccacggctg gcacagggca gtgtctgagc      6120
     tcatttgtct tttccttcag gaagtcgggg tgtaaaggga cggagagagg tgaggtgtgt      6180
     gcagtaagag gatttctcaa ggatgggaca ggagggcctt ggagctttgg cttcctcctg      6240
     tgaatttgtg gggtggggag cctggtgcac caacctgagg gacctgaggg agtagtatca      6300
     ggatgtggga ttgacccctg gacctttttt ctagaaagag gaaaaaatga agggaggagg      6360
     aggaggaagc tggggagatc acacctttga ttttcttgtt cctggaaagt gaaaggaagt      6420
     tcacctgcta ggagtgagaa ggtggacaca ttgggtgggg atgaggtgag tgacatgagc      6480
     ttaggaaagt tgctgaggta attggttgag agaggtgttc aaataaaaat aacgcaattg      6540
     gcaaaaactg ttactaagac tttgtagagg caccaatcag tgacatggca gcattttctt      6600
     tcacagtaat caactgccag attgcagaca gccctgatgc cagcctaagg agtgtgggtt      6660
     tctcctccag gcccgcaggt ccccaacctc actcctctga agactcttct ggagatcctc      6720
     tgtgatgcac agatctccag actcagtgcc cccagactca gattccctgg gtggggaggt      6780
     ctggggatct ctgcttgtaa tcagctccct agaggttccc atgtagccag ataagtattg      6840
     tcagaacact gaagattttt gaaaaatgaa aaagagaagg ttggagatgt gtcttcagaa      6900
     gactactaag ggtgctggct agaggaggga ccagaggcag ggagatgagg taggaaactg      6960
     ctattatttg tcagggaaat tgcaatcaag gcatgagtta gaacagggaa aacacagagg      7020
     caagggagag gtggaagggg gaggaaagaa gtagtgacaa ttccagggtg gatgtccacc      7080
     caaatctaga agtaattgag caaatgtttt ctgggcatta gagaaggcaa ctagaacaaa      7140
     caggaatcct tgccttggtg aaatgtattt gaactgggtc agaaatgagg ccattgggta      7200
     tcaggcctta actccagcgc accctggagg tcgctgatgt ggctccaggc tgacctgctc      7260
     ctgtcaaaga atattgagca agatgcctct cgtggaatgt tctgggacct taaaacagat      7320
     acccaagtat tccccctgat ttcatggttc ccagaagctc tatggggaag aaattgtagg      7380
     taattcacaa ctgagattta gacataagtt gaatagtgta atggacattg agttaaccga      7440
     ggtaatgaag tagtgagaca caggtgcccc tgaaataaac tcacattgag ggaagaggct      7500
     gacaatgtgg atcagtctga aaacaaggca aaaatacaat agggagtaag ggttgtgtgt      7560
     cagttcaaga ctgtactttt acctggccca gcgccatgtt agggtatttg tgttctccag      7620
     gaagtagaaa ggaaagaact gagtgattag ggacctagaa gactaatttg agacattcct      7680
     cttgatgagc tgttctctag ggtagtcctc tgaaagagct gttctctagt ggatctccct      7740
     gaatgaactg ttctctagga gcacttgacc cttttctgtg tttgtttttt gttttgtgtt      7800
     tgtgtttgtt tttgagacag gttctcactt tgtctcccag gctggagtgc tgtggcacca      7860
     tcatggctca ctgcagcctc aacctcctgg gctcaagtga tcctcctgcc tcagcctccc      7920
     atgtagctag aactacagat acacgtacca ccatgtctgg ctaatttatt tttcttttta      7980
     gagatgggtt ctcactatgt tgcccaggcc ggtctcaaaa ccctgggctc aagtgatcct      8040
     catgcctcaa cctcccaaag tgctaagatt ataggcatga ccaccatgcc tggccttttc      8100
     tgctttctga ggaggaaaaa ggtactggtg gcagagatcc aaaagaaaag ttgccagtgg      8160
     cagtgtggaa attcacctga gaacaacagg acaagctggg gcacaaatgc aaagatgcag      8220
     agggaggcaa cacctggtca tctgtgagac cttcatggga cctgaagacg cagcacagag      8280
     gaggaacttg aaaaaggacg ggatttctac tactcaagca tgtaggagct caggatattc      8340
     tgtaaatatg aagattttga gtttttgtag gtgaggtaaa aaaatacata ggttttttac      8400
     agaataagac atgtaaagct ctcttcattt tctttgtatt ttcatgaagt tattagattc      8460
     acaggccacc ataatgccat tgtctgtata tcttaatttc aagatattat ttgagtaaat      8520
     tttgcttcct ttgtatcaag atagaacttt gaaaaggtag gtaatttcac agttgatcaa      8580
     atattctttg cccaaattac ttttggttaa aatttctcct aaatgtgcta cagagtgcaa      8640
     actctgtctc cctgccattc cgctatatac ttactaacta ttattttatt caagatcatg      8700
     catgctctac ttgaaggtct atttctatct tttcaatgct acccttaccc actagcctaa      8760
     tcacattatt cctattttca acatctagga atcaattaca tagtgaacat gcctaagaaa      8820
     taataatctg ggcagatgca gtggctcagg cccgtaatcc cagccctttg agaggccgag      8880
     cgggtggatc acttgaggtc aggcgttggt caagtgctcc tagagaacca ggctgaccaa      8940
     catggagaaa ccttgtctct actaataata caaaaattag ccaggtgaag tggcaggcac      9000
     ctataatccc agctattcgg gaggctgagg aaggagaatt ggttgaagcc cggaggtgga      9060
     ggttgcagtg agccaatatt gcgccactgc attccagact tggcaacaga gtgacactcc      9120
     atctcaacaa aaagaaagaa tgaaagaaag aaagagcgag attatgtctc aaaaaaaagg      9180
     aaggaaggaa ggaaggaagg aaggaaggaa agaaggacaa tctcaaattc tatttcatta      9240
     tttttcttcc acgctcctag tccagcctag ggtgaatgtt tccccctcca agaaggggcc      9300
     cttgcagcac cacaacctgc ttgtctgcca cgtgacggat ttctacccag gcagcattca      9360
     agtccgatgg ttcctgaatg gacaggagga aacagctggg gtcgggtcca ccaacctgat      9420
     ccgtaatgga gactggacct tccagatcct ggtgatgctg gaaatgaccc cccagcaggg      9480
     agatgtctac acctgccaag tggagcacac cagcctggat agtcctgtca ccgtggagtg      9540
     gagtgagtct ctgatgaccc tctagacccc acctctgaag agcaggggac tctctggctc      9600
     tggggtccac tcatcttatc ttctgcatct ataccctggg gccatgtcca aaccccatct      9660
     ttcttctata ccagctcctg agcatagttt gaagccaggg aaatggagac ttcctgacct      9720
     tggcttaggg gttcctgaag attcatagtt ctcccccttg tcagagaatc tagggacact      9780
     gactggtctc gaaaccctca cacttaggaa ctgacctcac acataggaac agttctcttc      9840
     cttcagcatt ttagcctctt ctcaggcatt ttgagaggca acttccagaa tcagcatttg      9900
     ccaccttgtt gaggtcacac ccctgttcca gatatgaggg tggctctttc tgaatttcct      9960
     cttagcaagc tttttccact gcactgtcct catcccgata tgctgcatca ggctccagaa     10020
     tctcagacag gacatgagta gggatgcagc tggtggaggt gacactaaac ctgggtctgt     10080
     ccttcccaga ggcacagtct gattctgccc ggagtaagac attgacggga gctgggggct     10140
     tcgtgctggg gctcatcatc tgtggagtgg gcatcttcat gcacaggagg agcaagaaag     10200
     gtgagaaagc ctgcagggtg agcgggactt accttcccct ggcatattca cacttattcc     10260
     acgatgaggg gtttgacaga aaagaaatgt cagaaagctc tagaggccac tgatatcaga     10320
     taatcgggga acaaacatga cctatagcga gagagggatc ccaggctggg atcttaatgc     10380
     agccagatgc atgaggtccc aagtactcag gctcctgcgg agcgtccatt gagtgatggg     10440
     caatggaatt tggtgggatg gaaatgtttc tctaattatc tgaggtggtt tcaatggctg     10500
     attatataac ctttcgtctt tcatttcagt tcaacgagga tctgcataaa caggtaatat     10560
     tcctgctttg atttccttgt ggggtgggtt gcaggaggat atgagtcctt tctgtgcatt     10620
     gtaacactga ggctcctcca ggaagggaat ctcaggcatg aacccctctt tcaatgtcag     10680
     ccttcaggca agtggggaaa gagcattgct tggctccatt gctgaaggaa gcagagatca     10740
     actctgttat ttatcagcct gagacgcatc ctctcaccat aatttttctc tcctggactt     10800
     acaggaagga ggctggcaac ctgggataac ttgtctttta cccccacagg gttcctgagc     10860
     tcactgaaaa gactattgtg ccttaggaaa agcatttgct gtgtttcgtt agcatctggc     10920
     tccaggacag accttcaact tccaaattgg atactgctgc caagaagttg ctctgaagtc     10980
     agtttctatc attctgctct ttgattcaaa gcactgtttc tctcactggg cctccaacca     11040
     tgttcccttc ttcttagcac cacaaataat caaaacccaa catgactgtt tgttttcctt     11100
     taaaaatatg caccaaatca tctctcatca cttttctctg agggttttag tagacagtag     11160
     gagttaataa agaagttcat tttggtttaa acataggaaa gaagagaacc atgaaaatgg     11220
     ggatatgtta actattgtat aatggggcct gttacacatg acactcttct gaattgactg     11280
     tatttcagtg agctgccccc aaatcaagtt tagtgccctc atccatttat gtctcagacc     11340
     actattctta actattcaat ggtgagcaga ctgcaaatct gcctgatagg acccatattc     11400
     ccacagcact aattcaacat ataccttact gagagcatgt tttatcatta ccattaagaa     11460
     gttaaatgaa catcagaatt taaaatcata aatataatct aatacacttt aa             11512
//