Dbfetch

ID   LT882763; SV 1; linear; genomic DNA; STD; HUM; 11525 BP.
XX
AC   LT882763;
XX
DT   09-JUN-2017 (Rel. 133, Created)
DT   21-JUL-2017 (Rel. 133, Last updated, Version 2)
XX
DE   Homo sapiens, HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1738, allele HLA-DPB1*04:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11525
RA   Albrecht V.;
RT   ;
RL   Submitted (06-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; 1dc6aff7dea6e3f06c7b9a19a2e1ffd3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11525
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1738"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=1
FT   CDS             join(367..466,4996..5259,9274..9555,10103..10213,
FT                   10543..10562)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1Y6MV69"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y6MV69"
FT                   /protein_id="SMY44020.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQQCY
FT                   AFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..4995
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=1
FT   exon            4996..5259
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=2
FT   intron          5260..9273
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=2
FT   exon            9274..9555
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=3
FT   intron          9556..10102
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=3
FT   exon            10103..10213
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=4
FT   intron          10214..10542
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=4
FT   exon            10543..11525
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=5
XX
SQ   Sequence 11525 BP; 3135 A; 2538 C; 2990 G; 2862 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgaact       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtgtctt tggggaaaat       720
     gggaccaaga ggtcctggat aaccttggac agacaaggtt tgcagagaga gaagttggca       780
     agtgcaggct cctgggcgtg ttcatgtctg catccagcct ggaggggact caggcagaga       840
     gccctaagct ggagtgtcca ggctctgagg atcactgagg attcagtgct cacgaagaat       900
     gcctcttatt ccccagggtg gagcaggagc ccacatccct tggacaatta aggagagaag       960
     ggagggaggg ggataggttt tagcccctga aggcattctc attaaaggta cttctcccag      1020
     cctccccaga acttggttag ggtactagag tgggttgcga cttgtaggaa gaatgagatg      1080
     aggttgtgtg ggtgcatgac agggattgag tgtaggttat cagacagcca aggaagcagt      1140
     aaccaagtga aaaatctctt cttcctgctg cctccctgtg gctggtgtaa tattatggca      1200
     tctatgatcc attgtttttc tctcaggata ctctcaggat atttcttttt atatatatat      1260
     atactttaag ttctagggta catgtgcaca acgtgcaggt ttgttacata tgtatacatg      1320
     tgccatgttg gtgtgctgca cccattaact cgtcatttac attaggtata tttcctaatg      1380
     ctatccctcc cccctccccc caccccacaa caggccccgg tgtatgatgt tccccttcct      1440
     gtgtccatgt gttctcattg ttcagttccc acctatgagt gagaacatgt ggtctttggt      1500
     tttttgtcct tgcaatagtt tgctgtgaat gatgatttcc agcttcctcc atgtccctac      1560
     aaaggacatg aactcatcct tttttatggc tgcacagtat tccatggtgt atatgtgtgc      1620
     attttcttaa tccagtctat cactgatgga cagttgggtt ggttccaagt ctttgctatt      1680
     gtgaatagtg ccgcaataaa catatgtgtg catgtgtctt tatagcagca tgatttataa      1740
     tcctttgggt atatatccag taatgggatg gctgggtcaa atggtatttc tagttctaga      1800
     tctttgagga attgccacac tgtcttgaga taccatctca caccagttaa aatggcgatc      1860
     attaaaaagt caggaaacaa caggtgctgg agaggatgtg gagaaatagg aacactttta      1920
     ctctgttggt gggactgtaa actagttcaa ccattgtact ctcaggacat ttctagtcca      1980
     aatttacacc aacactctga gaggaaggac tgcaaagtag gtaccttagt tttccactga      2040
     cttccacttt tcctgcttac acccttcctc ctagacctct ccacacccct cctaggacac      2100
     acctagaagg tactgacatc atgtcacctc ctcatctttc agggtagcaa ggttggaatc      2160
     tcctgaatac agcccctcaa gccctaaaac ctcttatcta ttaccttggg ttcattgtcc      2220
     aggaagggga ggagaacttg aacttgtagt cacagaaggg tgctgagaac taaccagcag      2280
     gacggctcag ccctgggaac tgcagagggg tgaggctggg gagagaggag gctggagcag      2340
     cactggtgac actgaacagt gtcaggagga agtgacggat gcagcgcccc catcccatag      2400
     gcagagctgt catgtgggat gagggacagt gttgggagcc accaaggaaa cccagaggtg      2460
     ggggagcaga gagcagaagg gggcatgtga tgctgggcag tgaaagggag gacgggcaaa      2520
     ggctgggttg aggtttgtag ggggaatgag atgaggcagt ggagccatgt gacagggact      2580
     gagggtagat tactggagct ccctgcgtag aatgaatgtt caatcaaaac ctgctggagg      2640
     gagagctgga gccatagggg agtgggtaaa gtgggcaggg ctgattccac aattccctgc      2700
     atgctccccc aactccacac acatccccaa cctcaaacag ggcacaagac caaagggctg      2760
     aggagccagg ctatagctta aagaggctgg gggagaaaag cttggctgag acaacccata      2820
     gggagctaga ggtttttaat atatcctatt ctgaataaga gacgaattca ttcagatcag      2880
     tggtttcaaa ccgtgctctg ggcaactcaa ttgctaaggg ttccacaaac aggataaagt      2940
     ttcttatata caaaaaaaat gaaggtttca aattacacca taaaacccct cattgcttat      3000
     gtctacttgg caggtaaaat tccatttcaa aagttaaatg tacttaaaaa attacctaag      3060
     actgggtaaa ttaaaaaaat taaatgttgc aaagaaaaaa ttcaaaattc ttattcttga      3120
     atgaaaaacg ttctcttact ggtgattgag gaggagaaac aaagactaac aaatgaaaat      3180
     gggagaatcc acactcagag tggggcaatt gaacaggcag gggcggatgg atggcagagg      3240
     aggaggaatc tggactcaag gagctggggg gctctgggcc tggaatttta gggtctgggg      3300
     cccaaggcac caggagaaga ggcaggtcag gatatctgag tcaagacctg ggatcttgcc      3360
     ttagcaatga cactggagac taaaggtgga ctccatggtg cccttgagcc cagccctacc      3420
     ccatctccac tatcctctgc caccagctgt gcaacttctg ctaggggtga ggttaataaa      3480
     ctggagaagt taatttgtgg agcatgaaac agatgagcag aacaatcaca gcaccttaat      3540
     ttccccagtg tgcccaagaa cagagcaggc ctgaagatac tcaaacagaa acaaacatgt      3600
     gccgtgtcac tgataattct gtgtagacac acacctgcca gacactgctc atggcactcc      3660
     ctaggaagaa cagcatgtgg gaaaggctgc caaaattgtt catgtaaaaa ttacatcaat      3720
     gctgtcttcc tcggtgctgc ctatgcagct ggcagccatc tcttcctcca catcatggcc      3780
     tccctcagac tcctcatgaa ggataagatc ctcaaaaaga ggaccaacaa gttcatgagg      3840
     caccaatcag actgaaatgt caaaattaag cataactggc ggaaacccag aggtcttaac      3900
     agtagggttc gtagaaggtc caagggccag atcttgatgc ccaacattgc ttatgggagc      3960
     aacaacaaca acaaaaaaaa catgctgccc agtggcttcc agaagtttct ggtccacagc      4020
     ctcaaggagc tgaaagtgct gctgatgtgc aacaaatctt actgtgctga gatcgctcac      4080
     aaaatttcct ccagaactgc aaagtcatca tggaaagagt cacccagccg gccatcagag      4140
     tcaccaaccc cagtaccagg gtgcacagct aagaaaatga gtagaaagtt catgtccacg      4200
     ttttgtgtgt aaataaaacc ataaaaactg ccaaaaaaaa ttacatcaat gcctctaaac      4260
     ccaaaggact ctacccccac aggtccctgg ttgttgtggt gattttcatt gtgtaaaata      4320
     ctttccacat cttttgacac caagtctttc tgcagccatg tttgaaaatt aactttcagg      4380
     ctacagagtc tttcttatac caaagttgaa gaaagtttta agaaatatat ttctacatct      4440
     cctacatgca aaacaacagg agcaagttga ggaattctca agaaactggt cgagaagaga      4500
     gagcgcttag ctatggaaaa gagaaagaag gaagggaggg cttcctggag gaggtggcat      4560
     ttgaaccagg actgacatca ggatggaaat gtcagtcagg gagttaagta gggggagcag      4620
     ctccgccctc cacgtcccca gctcctcccg cccctgtttt ttctcccagt gaccccacgt      4680
     gaaacgtctc cgcctcctcc agccaccagc agaagggact gccttcccct cagtgctcgc      4740
     ccctccctag tgatcactca gtgcccctga gctcattctt ttcagtaaat tctctctctg      4800
     cgtggtgaga aaacaggcct ggagaggctc tgcgacccgc ttaggaccac agaactcggt      4860
     actaggaaaa ctcctatttt aaaatccagc cctgggtggg aagatttggg aagaatcgtt      4920
     aatattgaga gagagaggga gaaagaggat tagatgagag tggcgcctcc gctcatgtcc      4980
     gccccctccc cgcagagaat taccttttcc agggacggca gcaatgctac gcgtttaatg      5040
     ggacacagcg cttcctggag agatacatct acaaccggga ggagttcgcg cgcttcgaca      5100
     gcgacgtggg ggagttccgg gcggtgacgg agctggggcg gcctgctgcg gagtactgga      5160
     acagccagaa ggacatcctg gaggagaagc gggcagtgcc ggacaggatg tgcagacaca      5220
     actacgagct gggcgggccc atgaccctgc agcgccgagg tgagtgaggg ctttgggccg      5280
     gcggtcccag ggcagccccg cgggcccgtg cccagggcgc aggagcagcc gggttggcct      5340
     aagggacctt agtgccgggc ggaaagggga ctttgggttg gggattcatg gggggagccc      5400
     atctggagct tgtcagggga gcgagcgcgg ggacctggac tgggctgagc atggagtgag      5460
     gaggacgaga gcagagagac ccccgggact tcatcaggcc tggcagctga ctgcatgtgg      5520
     ggtgaaaaaa ggaagccaca ggacagcgca caagggtatg gtgtggagat ggaggtggag      5580
     atggcacagc aggccacaca gagaagaaac ctacagggag gtagctgggt ttgaggtgct      5640
     tgaggggcag atgggtggtc tgatgggcag gtagacagaa gggtctgcag ccggggagga      5700
     gactgagata catgagacca tccagggaga ggggacccag ggggaagagc aaaggaccgg      5760
     atcctgggaa ctggacagtt gtgatttggc caagacagaa aagcctgtga aagagaccaa      5820
     aaaaacccaa gtgcagtgtg aggagaggcc cgcagagaag agtcttggaa gctgagggga      5880
     ggtgacctca gcagcacagt ggacagcggt gccagtgact tgggaaggtc agaaaacaga      5940
     agatggaaag tgggtttgga aaccagggag acctggggag agcaggttgg ccgcagcggc      6000
     aggagctgga atgggagggg gtgcatgagg ctgagtgtgg cgcatcctcc tcggggctga      6060
     gatggatttt acttgtcttg ggttccccac ggctgtcaca gggcagtgtc tcagttcatt      6120
     cgtctttttc cttcaggaag tctgggtgta aagggatgga gagaggtgag gtgtgtgcag      6180
     taagaggatt tctcaaggat gggacaggaa ggccttggag ctttggcttc ctcctgtgaa      6240
     cttgtggggt ggggagcctg gtgcaccaac ctgagggact tgagggagta gtatcaggat      6300
     gtgggattga gccctggacc ttttttctag aaagaggaaa aaaatgaagg gaggaggagg      6360
     aggaagctgg ggagatcaca cctttgattt tcttgttcct ggaaagtgaa aggaagttca      6420
     cctgctatga gtgagaaggt ggacacactg ggtggggatg aggtgagtga catgagctta      6480
     ggaaagttgc tgaggtaatt ggttgagaga ggtgttcaaa taaaaataac gcaattggca      6540
     aaaactgtta ctaagacttt gtagaggcac caatcagtga catggcagca ttttctttca      6600
     cagtaatcaa ctgccagatt gcagacagcc ctgatgccag cctaaggagt gtgggtttct      6660
     cctccaggcc cgcaggtccc caacctcact cctctgaaga ctcttctgga gatcctctgt      6720
     gatgcacaga tctccagact cagtgccccc agactcagat tccctgggtg gggaggtctg      6780
     gggatctctg cttgtaatca gctccctaga ggttcccatg tagccagata agtattgtca      6840
     gaacactgaa gatttttgaa aaatgaaaaa gagaaggttg gagatgtgtc ttcagaagac      6900
     tactaagggt gctggctaga ggagggacca gaggcaggga gatgaggtag gaaactgcta      6960
     ttatttgtca gggaaattgc aatcaaggca tgagttagaa cagggaaaac acagaggcaa      7020
     gggagaggtg gaagggggag gaaagaagta gtgacaattc cagggtggat gtccacccaa      7080
     atctagaagt aattgagcaa atgttttctg ggcattagag aaggcaacta gaacaaacag      7140
     gaatccttgc cttggtgaaa tgtatttgaa ctgggtcaga aatgaggcca ttgggtatca      7200
     ggccttaact ccagcgcacc ctggaggtca ctgatgtggc tccaggctga cctgctcctg      7260
     tcaaagaata ttgagcaaga tgcctctcgt ggaatgttct gggaccttaa aacagatacc      7320
     caagtattcc ccctgatttc atggttccca gaagctctat ggggaagaaa ttgtaggtaa      7380
     ttcacaactg agatttagac ataagttgaa tagtgtaatg gacattgagt taaccgaggt      7440
     aatgaagtag tgagacacag gtgcccctga aataaactca cattgaggga agaggctgac      7500
     aatgtggatc agtctgaaaa caaggcaaaa atacaatagg gagtaagggt tgtgtgtcag      7560
     ttcaagactg tacttttacc tggcccagcg ccatgttagg gtatttgtgt tctccaggaa      7620
     gtagaaagga aagaactgag tgattaggga cctagaagac taatttgaga cattcctctt      7680
     gatgagctgt tctctagggt agtcctctga aagagctgtt ctctagtgga tctccctgaa      7740
     tgaactgttc tctaggagca cttgaccctt ttctgtgttt gttttttgtt ttgtgtttgt      7800
     gtttgttttt gagacaggtt ctcactttgt ctcccaggct ggagtgctgt ggcaccatca      7860
     tggctcactg cagcctcaac ctcctgggct caagtgatcc tcctgcctca gcctcccatg      7920
     tagctagaac tacagataca cgtaccacca tgtctggcta atttattttt ctttttagag      7980
     atgggttctc actatgttgc ccaggccggt ctcaaaaccc tgggctcaag tgatcctcat      8040
     gcctcaacct cccaaagtgc taagattata ggcatgacca ccatgcctgg ccttttctgc      8100
     tttctgagga ggaaaaaggt actggtggca gagatccaaa agaaaagttg ccagtggcag      8160
     tgtggaaatt cacctgagaa caacaggaca agctggggca caaatgcaaa gatgcagagg      8220
     gaggcaacac ctggtcatct gtgagacctt catgggacct gaagacgcag cacagaggag      8280
     gaacttgaaa aaggacggga tttctactac tcaagcatgt aggagctcag gatattctgt      8340
     aaatatgaag attttgagtt tttgtaggtg aggtaaaaaa atacataggt tttttacaga      8400
     ataagacatg taaagctctc ttcattttct ttgtattttc atgaagttat tagattcaca      8460
     ggccaccata atgccattgt ctgtatatct taatttcaag atattatttg agtaaatttt      8520
     gcttcctttg tatcaagata gaactttgaa aaggtaggta atttcacagt tgatcaaata      8580
     ttctttgccc aaattacttt tggttaaaat ttctcctaaa tgtgctacag agtgcaaact      8640
     ctgtctccct gccattccgc tatatactta ctaactatta ttttattcaa gatcatgcat      8700
     gctctacttg aaggtctatt tctatctttt caatgctacc cttacccact agcctaatca      8760
     cattattcct attttcaaca tctaggaatc aattacatag tgaacatgcc taagaaataa      8820
     taatctgggc agatgcagtg gctcaggccc gtaatcccag ccctttgaga ggccgagcgg      8880
     gtggatcact tgaggtcagg cgttggtcaa gtgctcctag agaaccaggc tgaccaacat      8940
     ggagaaacct tgtctctact aataatacaa aaattagcca ggtgaagtgg caggcaccta      9000
     taatcccagc tattcgggag gctgaggaag gagaattggt tgaagcccgg aggtggaggt      9060
     tgcagtgagc caatattgcg ccactgcatt ccagacttgg caacagagtg acactccatc      9120
     tcaacaaaaa gaaagaatga aagaaagaaa gagcgagatt atgtctcaaa aaaaaggaag      9180
     gaaggaagga aggaaggaag gaaggaagga aggaaggaag gaaagaagga caatctcaaa      9240
     ttctatttca ttatttttct tccacgctcc tagtccagcc tagggtgaat gtttccccct      9300
     ccaagaaggg gcccttgcag caccacaacc tgcttgtctg ccacgtgacg gatttctacc      9360
     caggcagcat tcaagtccga tggttcctga atggacagga ggaaacagct ggggtcgtgt      9420
     ccaccaacct gatccgtaat ggagactgga ccttccagat cctggtgatg ctggaaatga      9480
     ccccccagca gggagatgtc tacacctgcc aagtggagca caccagcctg gatagtcctg      9540
     tcaccgtgga gtggagtgag tctctgatga ccctctagac cccacctctg aagagcaggg      9600
     gactctctgg ctctggggtc cactcatctt atcttctgca tctataccct ggggccatgt      9660
     ccaaacccca tctttcttct ataccagctc ctgagcatag tttgaagcca gggaaatgga      9720
     gacttcctga ccttggctta ggggttcctg aagattcata gttctccccc ttgtcagaga      9780
     atctagggac actgactggt ctcgaaaccc tcacacttag gaactgacct cacacatagg      9840
     aacagttctc ttccttcagc attttagcct cttctcaggc attttgagag gcaacttcca      9900
     gaatcagcat ttgccacctt gttgaggtca cacccctgtt ccagatatga gggtggctct      9960
     ttctgaattt cctcttagca agctttttcc gctgcactgt cctcatcccg atatgctgca     10020
     tcaggctcca gaatctcaga caggacatga gtagggatgc agctggtgga ggtgacacta     10080
     aacctgggtc tgtccttccc agaggcacag tctgattctg cccggagtaa gacattgacg     10140
     ggagctgggg gcttcgtgct ggggctcatc atctgtggag tgggcatctt catgcacagg     10200
     aggagcaaga aaggtgagaa agcctgcagg gtgagcggga cttaccttcc cctggcatat     10260
     tcacacttat tccacgatga ggggtttgac agaaaagaaa tgtcagaaag ctctagaggc     10320
     cactgatatc agataatcgg ggaacaaaca tgacctatag cgagagaggg atcccaggct     10380
     gggatcttaa tgcagccaga tgcatgaggt cccaagtact caggctcctg cggagcgtcc     10440
     attgagtgat gggcaatgga atttggtggg atggaaatgt ttctctaatt atctgaggtg     10500
     gtttcaatgg ctgattatat aacctttcgt ctttcatttc agttcaacga ggatctgcat     10560
     aaacaggtaa tattcctgct ttgatttcct tgtggggtgg gttgcaggag gatatgagtc     10620
     ctttctgtgc attgtaacac tgaggctcct ccaggaaggg aatctcaggc atgaacccct     10680
     ctttcaatgt cagccttcag gcaagtgggg aaagagcatt gcttggctcc attgctgaag     10740
     gaagcagaga tcaactctgt tatttatcag cctgagacgc atcctctcac cataattttt     10800
     ctctcctgga cttacaggaa ggaggctggc aacctgggat aacttgtctt ttacccccac     10860
     agggttcctg agctcactga aaagactatt gtgccttagg aaaagcattt gctgtgtttc     10920
     gttagcatct ggctccagga cagaccttca acttccaaat tggatactgc tgccaagaag     10980
     ttgctctgaa gtcagtttct atcattctgc tctttgattc aaagcactgt ttctctcact     11040
     gggcctccaa ccatgttccc ttcttcttag caccacaaat aatcaaaacc caacatgact     11100
     gtttgttttc ctttaaaaat atgcaccaaa tcatctctca tcacttttct ctgagggttt     11160
     tagtagacag taggagttaa taaagaagtt cattttggtt taaacatagg aaagaagaga     11220
     accatgaaaa tggggatatg ttaactattg tataatgggg cctgttacac atgacactct     11280
     tctgaattga ctgtatttca gtgagctgcc cccaaatcaa gtttagtgcc ctcatccatt     11340
     tatgtctcag accactattc ttaactattc aatggtgagc agactgcaaa tctgcctgat     11400
     aggacccata ttcccacagc actaattcaa catatacctt actgagagca tgttttatca     11460
     ttaccattaa gaagttaaat gaacatcaga atttaaaatc ataaatataa tctaatacac     11520
     tttaa                                                                 11525
//