Dbfetch

ID   LT882760; SV 1; linear; genomic DNA; STD; HUM; 11461 BP.
XX
AC   LT882760;
XX
DT   09-JUN-2017 (Rel. 133, Created)
DT   21-JUL-2017 (Rel. 133, Last updated, Version 2)
XX
DE   Homo sapiens, HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1735, allele HLA-DPB1*03:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11461
RA   Albrecht V.;
RT   ;
RL   Submitted (06-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; 17146418418c3c4d5d61df7fcd9e01d1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11461
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1735"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=1
FT   CDS             join(367..466,4996..5259,9210..9491,10039..10149,
FT                   10479..10498)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1Y6MTJ5"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y6MTJ5"
FT                   /protein_id="SMY44017.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQLRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEKRAVPDR
FT                   VCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTMEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..4995
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=1
FT   exon            4996..5259
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=2
FT   intron          5260..9209
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=2
FT   exon            9210..9491
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=3
FT   intron          9492..10038
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=3
FT   exon            10039..10149
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=4
FT   intron          10150..10478
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=4
FT   exon            10479..11461
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*03:new"
FT                   /number=5
XX
SQ   Sequence 11461 BP; 3105 A; 2541 C; 2964 G; 2851 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgaact       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtgtctt tggggaaaat       720
     gggaccaaga ggtcctggat aaccttggac agacaaggtt tgcagagaga gaagttggca       780
     agtgcaggct cctgggcgtg ttcatgtctg catccagcct ggaggggact caggcagaga       840
     gccctaagct ggagtgtcca ggctctgagg atcactgagg attcagtgct cacgaagaat       900
     gcctcttatt ccccagggtg gagcaggagc ccacatccct tggacaatta aggagagaag       960
     ggagggaggg ggataggttt tagcccctga aggcattctc attaaaggta cttctcccag      1020
     cctccccaga acttggttag ggtactagag tgggttgcga cttgtaggaa gaatgagatg      1080
     aggttgtgtg ggtgcatgac agggattgag tgtaggttat cagacagcca aggaagcagt      1140
     aaccaagtga aaaatctctt cttcctgctg cctccctgtg gctggtgtaa tattatggca      1200
     tctatgatcc attgtttttc tctcaggata ctctcaggat atttcttttt atatatatat      1260
     atactttaag ttctagggta catgtgcaca acgtgcaggt ttgttacata tgtatacatg      1320
     tgccatgttg gtgtgctgca cccattaact cgtcatttac attaggtata tttcctaatg      1380
     ctatccctcc cccctccccc caccccacaa caggccccgg tgtatgatgt tccccttcct      1440
     gtgtccatgt gttctcattg ttcagttccc acctatgagt gagaacatgt ggtctttggt      1500
     tttttgtcct tgcaatagtt tgctgtgaat gatgatttcc agcttcctcc atgtccctac      1560
     aaaggacatg aactcatcct tttttatggc tgcacagtat tccatggtgt atatgtgtgc      1620
     attttcttaa tccagtctat cactgatgga cagttgggtt ggttccaagt ctttgctatt      1680
     gtgaatagtg ccgcaataaa catatgtgtg catgtgtctt tatagcagca tgatttataa      1740
     tcctttgggt atatatccag taatgggatg gctgggtcaa atggtatttc tagttctaga      1800
     tctttgagga attgccacac tgtcttgaga taccatctca caccagttaa aatggcgatc      1860
     attaaaaagt caggaaacaa caggtgctgg agaggatgtg gagaaatagg aacactttta      1920
     ctctgttggt gggactgtaa actagttcaa ccattgtact ctcaggacat ttctagtcca      1980
     aatttacacc aacactctga gaggaaggac tgcaaagtag gtaccttagt tttccactga      2040
     cttccacttt tcctgcttac acccttcctc ctagacctct ccacacccct cctaggacac      2100
     acctagaagg tactgacatc atgtcacctc ctcatctttc agggtagcaa ggttggaatc      2160
     tcctgaatac agcccctcaa gccctaaaac ctcttatcta ttaccttggg ttcattgtcc      2220
     aggaagggga ggagaacttg aacttgtagt cacagaaggg tgctgagaac taaccagcag      2280
     gacggctcag ccctgggaac tgcagagggg tgaggctggg gagagaggag gctggagcag      2340
     cactggtgac actgaacagt gtcaggagga agtgacggat gcagcgcccc catcccatag      2400
     gcagagctgt catgtgggat gagggacagt gttgggagcc accaaggaaa cccagaggtg      2460
     ggggagcaga gagcagaagg gggcatgtga tgctgggcag tgaaagggag gacgggcaaa      2520
     ggctgggttg aggtttgtag ggggaatgag atgaggcagt ggagccatgt gacagggact      2580
     gagggtagat tactggagct ccctgcgtag aatgaatgtt caatcaaaac ctgctggagg      2640
     gagagctgga gccatagggg agtgggtaaa gtgggcaggg ctgattccac aattccctgc      2700
     atgctccccc aactccacac acatccccaa cctcaaacag ggcacaagac caaagggctg      2760
     aggagccagg ctatagctta aagaggctgg gggagaaaag cttggctgag acaacccata      2820
     gggagctaga ggtttttaat atatcctatt ctgaataaga gacgaattca ttcagatcag      2880
     tggtttcaaa ccgtgctctg ggcaactcaa ttgctaaggg ttccacaaac aggataaagt      2940
     ttcttatata caaaaaaaat gaaggtttca aattacacca taaaacccct cattgcttat      3000
     gtctacttgg caggtaaaat tccatttcaa aagttaaatg tacttaaaaa attacctaag      3060
     actgggtaaa ttaaaaaaat taaatgttgc aaagaaaaaa ttcaaaattc ttattcttga      3120
     atgaaaaacg ttctcttact ggtgattgag gaggagaaac aaagactaac aaatgaaaat      3180
     gggagaatcc acactcagag tggggcaatt gaacaggcag gggcggatgg atggcagagg      3240
     aggaggaatc tggactcaag gagctggggg gccctgggcc tggaatttca gggtctggcg      3300
     cccaaggcac caggagaaga ggcaggtcag gatatctgag tcaagacctg ggatcttgcc      3360
     ttagcaatga cactggagac taaaggtgga ctccatggtg cccttgagcc cagccctacc      3420
     ccatctccac tatcctctgc caccagctgt gcaacttctg caaggggtga ggttaataaa      3480
     ctggagaagt taatttgtgg agcatgaaac agatgagcag aacaatcaca gcaccttaat      3540
     ttccccagtg tgcccaagaa cagagcaggc ctgaagacac tcaaacagaa acaaacatgt      3600
     gccgtgtcac tgataattct gtgtagacac acacctgcca gacactgctc atggcactcc      3660
     ctaggaagaa cagcatgtgg gaaaggctgc caaaattgtt catgtaaaaa ttacatcaat      3720
     gctgtcttcc tcggtgctgc ctatgcagct ggcagccatc tcttcctcca catcatggcc      3780
     tccctcagac tcctcatgaa ggataagatc ctcaaaaaga ggaccaacaa gttcatgagg      3840
     caccaatcag actgaaatgt caaaattaag cataactggc ggaaacccag aggtcttaac      3900
     agtagggttc gtagaaggtc caagggccag atcttgatgc ccaacattgc ttatgggagc      3960
     aacaacaaca acaaaaaaca catgctgccc agtggcttcc agaagtttct ggcccacagc      4020
     ctcaaggagc tgaaagtgct gctgatgtgc aacaaatctt actgtgctga gatcgctcac      4080
     aaaatttcct ccagaactgc aaagtcatca tggaaagagt cacccagccg gccatcagag      4140
     tcaccaaccc cagtaccacg gtgcacagct aagaaaatga gtagaaagtt catgtccacg      4200
     ttttgtgtgt aaataaaacc ataaaaactg ccaaaaaaaa ttacatcaat gcctctaaac      4260
     ccaaaggact ctacccccac aggtccctgg ttgttgtggt gattttcatt gtgtaaaata      4320
     ctttccacat cttttgacac caagtctttc tgcagccatg tttgaaaatt aactttcagg      4380
     ctacagagtc tttcttatac caaagttgaa gaaagtttta agaaatatat ttctacatct      4440
     cctacatgca aaacaacagg agcaagttga ggaattctca agaaactggt cgagaagaga      4500
     gagcgcttag ctatggaaaa gagaaagaag gaagggaggg cttcctggag gaggtggcat      4560
     ttgaaccagg actgacatca ggatggaaat gtcagtcagg gagttaagta gggggagcag      4620
     ctccgccctc cacgtcccca gctcctcctg cccctgtttt ttctcccagt gaccccacgt      4680
     gaaacgtctc cgcctcctcc agccaccagc agaagggact gccttcccct cagtgctcgc      4740
     ccctccctag tgatcactca gtgcccctga gctcattctt ttcagtaaat tctctctctg      4800
     cgtggtgaga aaacaggcct ggagaggctc tgcgacccgc ttaggaccac agaactcggt      4860
     actaggaaaa ctcctatttt aaaatccagc cctgggtggg aagatttggg aagaatcgtt      4920
     aatattaaga gagagaggga gaaagaggat tagatgagag tggcgcctcc gctcatgtcc      4980
     gccccctccc cgcagagaat tacgtgtacc agttacggca ggaatgctac gcgtttaatg      5040
     ggacacagcg cttcctggag agatacatct acaaccggga ggagttcgtg cgcttcgaca      5100
     gcgacgtggg ggagttccgg gcggtgacgg agctggggcg gcctgatgag gactactgga      5160
     acagccagaa ggacctcctg gaggagaagc gggcagtgcc ggacagggta tgcagacaca      5220
     actacgagct ggacgaggcc gtgaccctgc agcgccgagg tgagtgaggg ctttgggccg      5280
     gcggtcccag ggcagccccg cgggcccgtg cccagggcgc aggagcagcc gggttggcct      5340
     aagggacctt agtgccgggc ggaaagggga ctttgggttg gggattcatg gggggagccc      5400
     atctggagct tgtcagggga gcgagcgcgg ggacctggac tgggctgagc atggagtgag      5460
     gaggacgaga gcagagagac ccccgggact tcatcaggcc tggcagctga ctgcatgtgg      5520
     ggtgaaaaaa ggaagccaca ggacagcgca caagggtatg gtgtggagat ggaggtggag      5580
     atggcacagc aggccacaca gagaagaaac ctacagggag gtagctgggt ttgaggtgct      5640
     tgaggggcag atgggtggtc tgatgggcag gtagacagaa gggtctgcag ccggggagga      5700
     gactgagata catgagacca tccagggaga ggggacccag ggggaagagc aaaggactgg      5760
     atcctgggaa ctggacagtt gtgatttggc caagacagaa aagcctgtga aagagaccaa      5820
     aaaaacccaa gtgcagtgtg aggagaggcc cgcagagaag agtcttggaa gctgagggga      5880
     ggtgacctca gcagcacagt ggacagcggt gccagtgact tgggaaggtc agaaaacaga      5940
     agatggaaag tgggtttgga aaccagggag acctggggag agcaggttgg ccgcagcggc      6000
     aggagctgga atgggagggg gtgcatgagg ctgagtgtgg cgcatcctcc tcggggctga      6060
     gatggatttt acttgtcttg ggttccccac ggctgtcaca gggcagtgtc tcagttcatt      6120
     cgtctttttc cttcaggaag tctgggtgta aagggatgga gagaggtgag gtgtgtgcag      6180
     taagaggatt tctcaaggat gggacaggaa ggccttggag ctttggcttc ctcctgtgaa      6240
     cttgtggggt ggggagcctg gtgcaccaac ctgagggact tgagggagta gtatcaggat      6300
     gtgggattga gccctggacc ttttttctag aaagaggaaa aaaatgaagg gaggaggagg      6360
     aggaagctgg ggagatcaca cctttgattt tcttgttcct ggaaagtgaa aggaagttca      6420
     cctgctatga gtgagaaggt ggacacactg ggtggggatg aggtgagtga catgagctta      6480
     ggaaagttgc tgaggtaatt ggttgagaga ggtgttcaaa taaaagtaat gcaattggca      6540
     aaaactgtta ctaagacttt gtagaggcac aaatcagtga cacggcagca tcttctttca      6600
     cagtaatcaa ctgccagatt gcagggagcc ttgataccag cctaaggagt gtgagtttct      6660
     cctctaggcc cacaggtccc caacctcact tctccgaaga ctctcctgga gatcatctgt      6720
     gatgcgcaga tacccagact cactgccccg agactcagat tccctgggta gggaggtcgg      6780
     gggatctctg cttgtaatca gctccctaga ggttcccatg tagccggata agtattgtca      6840
     gaacactgaa gatttttgaa aaatgaaaaa gcgaaggttg gagatgtgtc ttcagaagac      6900
     tactaagggt gctgggtaga ggagggacca gaggcaggga aatgaggtag gaaactgcta      6960
     ttatttgtca gggaaattgc aatcaagaaa tgagttagaa cagggaaaag acagaggcag      7020
     gggagaggtg gaagggggag gaaaggagta gtgacaattc cagggtgtat gctcacccaa      7080
     atctagaagt aattgagcaa atgttttctg ggcattagag aaggcaacta gaacaaacag      7140
     gaatccttgc cttggtgaaa tgtatttgaa ctgggtcaga aatgaggcca ttgggtatca      7200
     agccttaact ccagcgcccc ctggaggtcg ctgatgtggc tccaggctga cctgctcctg      7260
     tcaaagaata ttgagcaaga tgcctctcat ggaatgttct gggaccttaa aacagatacc      7320
     caagtattcc ccctgatttc atggttccca gaagctctat ggggaagaaa ttgtacgtaa      7380
     ttcacaactg agatttagac ataagttgaa tagtgtaatg gacgttgagt taaccgaggt      7440
     aatgaagtag tgagacacag gtgcccctga aataaactca cattgaggga agaggctgac      7500
     aatgtggatc agtctgtaaa caaggcaaaa atacaatagg gagtaagggt tgtgtgtcag      7560
     ttcaagactg tacttttacc tggcccagcg ccatgttggg gtatttgtgt tctccaggaa      7620
     gtagaaagga aagaactgag tgattaggga cctagaagac taatttgaga cattcctctt      7680
     gatgaactgt tctctagggt agtcctctga aagagctgtt ctctagtgga tctccctgaa      7740
     tgaactgttc tctaggagca cttgaccctt ttctgtgttt gttttttgtt ttgtgtttgt      7800
     gtttgttttt gagacaggtt ctcgctctgt ctcccaggct ggagtgctgt ggcgccatca      7860
     tgactcactg cagcctcaac ctcctgggct caagtgatcc tcctgcctca gcctcccatg      7920
     tagctagaac tacagataca tgtaccacca tgtctggcta atttattttt ctttttagag      7980
     atgggttctc actatgttgc ccaggctggt ctcgaaaccc tgggctcaag tgatcctcac      8040
     gcctcagcct cccaaagtgc taagattata ggcatgacca ccatgcctgg ccttttctgc      8100
     cttccgagaa ggaaaaaggt actggtggca gagatccaaa agaaaagttg ccagtggcag      8160
     tgtggaaatt gacctgagaa caacagaaca agctggggca caaatgcaaa gatgcagagg      8220
     gaggcaacat ctggttatct gtgagacctt catgggacct gaagacacat ccttttggaa      8280
     aaggatggga tttctactac tcaagcatgt aggggctcag gatattatgt aaatatgaag      8340
     attttgagtt tttgtaagtg aggtaaaaaa aatacctagg ttatttacag aataagacat      8400
     gtcaagctct cttcattttc tttgtatttt catgaaataa aggtattaga ttaacaggcc      8460
     accataatgc cattgtctgt atatcttaat ttcaagatat tatttgagta atttttgcat      8520
     cctttgtatc aagatagaac tttgaaaaga caggtaattt cacagttgat taaatattct      8580
     ttgcccaaat tacttttggt taaaatttct cctatatgtg ctacagagtg caaactctgt      8640
     ctccctgcca ttccgctata tacttactaa ttattatttt attcaagatc atgcatgctc      8700
     tacttgaagg tctatctttt cagtgctacc cttacccact agcctaatca cattatatct      8760
     attttcaaca tctaggaatc aattacgtag tgaacatgcc taagaaataa taatctgggc      8820
     agatgcagtg gctcaggcct gtaatcccag cactttgaga ggctgagcgg gtggatcact      8880
     tgaggtcagg agttggtcaa gtgctcctag agaaccagcc tgaccaacat ggagaaacct      8940
     tgtctctact gataatacaa aaattagcca ggtgaggtgg caggcaccta taatcccagc      9000
     tattcgggag gctgaggaag gagaattgct tgaacccctg aggtggaggt tgcagtgagc      9060
     caatattgcg ccactgcatt ccagacttgg caacagagcg acactccacc tcaacaaaaa      9120
     gaaagaaaga gcgagattac gtctcaaaaa aggaaggaag gaaggacaat ctcaaatgct      9180
     atttcattat tttccttccc cactcgtagt ccagcctaag gtgaacgttt ccccctccaa      9240
     gaaggggccc ctgcagcacc acaacctgct tgtctgccac gtgacagatt tctacccagg      9300
     cagcattcaa gtccgatggt tcctgaatgg acaggaggaa acagctgggg tcgtgtccac      9360
     caacctgatc cgtaatggag actggacctt ccagatcctg gtgatgctgg aaatgacccc      9420
     ccagcaggga gacgtctaca tctgccaagt ggagcacacc agcctggaca gtcctgtcac      9480
     catggagtgg agtgagtctc tgatgaccgt ctagacccca cctctgaaga gcaggggact      9540
     ctctggctct ggggtccact catcttatct tctgcatcta taccctgggg ccatgtccaa      9600
     accccatctt tcttctatac cagctcctga gcatagtttg aagccagggc aatggagact      9660
     tcctgacctt ggcttagggg ttcctgaaga ttcatagttc tcccccttgt cagagaatct      9720
     agggacactg gctgatctcg aaaccctcac acacaggaac tgacctcaca cataggaaca      9780
     gttctcttct ttcagcattt tagcctcttc tcaggcattt tgagaggcaa cttctagaat      9840
     cagcatttgc caccttgttg aggtcacacc cctgttccgg acatgagggt ggctctttct      9900
     gaatttcctc ttagcaagct ttttcccctg cactgtcttc atcccgatat tctgcatcac      9960
     gctccagaat ctcagacagg acatgagtag ggatgcagct ggtggaggtg acactaaacc     10020
     tgggtctgtc cttcccagag gcacagtctg attctgcccg gagtaagaca ttgacgggag     10080
     ctgggggctt cgtgctgggg ctcatcatct gtggagtggg catcttcatg cacaggagga     10140
     gcaagaaagg tgagaaagcc tgcaaggtga gcgggactta ccttcccctg gcatattcac     10200
     acttactcca tgatgagggt tcagacagaa aagaaatgtc agaaagctct agagaccact     10260
     gaaatcagat agtcggggaa caaacatgac ctatggcgag agggggatcc caggctggga     10320
     tcttaatgca gccagatgca tgaggtccca ggtgctcaga ctcctgcggg gcatccattg     10380
     agtggtggtc aatggaattt ggtgggatgg aaatgtttct ctaactatct gaggtggttt     10440
     caatggctga atacataacc tttcctcttt catttcagtt caacgaggat ctgcataaac     10500
     aggtaatatt cctgctttga tttccttggg gggtgggtta caggaggata tgactctttt     10560
     ctgtgcattg taatactgag gctcctccag gaagggaatc tcaggcatga acccctcttt     10620
     caacctcggc tctcgggtga gtggggaaaa agcattgcac ggctccattg ctgaaggaag     10680
     cagagatcag ttctgttctt tatcagccta agatgcagcc tctcaccata atttttctct     10740
     cctggactta aaggaaggag gccagcaacc tgggataact tgtcctttac ccccacaggg     10800
     ttcctgacct caccgaaaag actaatgtgc cttagaacaa gcatttgctg tgttttgtta     10860
     gcacctggtt ccaggacaga ccctcagctt cccaagagga tactgctgcc aagaagttgc     10920
     tctgaagtca gtttctatcg ttctgctctt tgattcaaag cactgtttct ctcactgggc     10980
     ctccaaccat gttcccttct tcttagcacc acaaataatc aaaacccaac ataagtgttt     11040
     gttttccttt aaaaatatgc atcaaatcgt ctctcattac ttttctctga gggttttagt     11100
     aaacagtagg agttaataaa gaagttcatt ttggtttaca cgtaggaaag aagagaagca     11160
     tgaaagtgga gatatgttaa ctattgtata atgtggcctg ttatacatga cactcttctg     11220
     aattgactgt atttcagtga gctgccccca aatcaagttt agtgccctca tccatttatg     11280
     tctcagaccg ctattcttaa ctattcaatg gtgagcagac tgcaaatctg cctgatagga     11340
     cccgtattcc cacagcacta attcaacata tatcttactg agagcatgtt ttatcattac     11400
     cattaagaag ttaaatgaac atcagaattt aaaatcataa atataatcta atacacttta     11460
     a                                                                     11461
//