Dbfetch

ID   LT882758; SV 2; linear; genomic DNA; STD; HUM; 11466 BP.
XX
AC   LT882758;
XX
DT   09-JUN-2017 (Rel. 133, Created)
DT   15-AUG-2017 (Rel. 133, Last updated, Version 3)
XX
DE   Homo sapiens, HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1733, allele HLA-DPB1*05:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11466
RA   Albrecht V.;
RT   ;
RL   Submitted (06-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; d9b1a51445d91b14e3d91c68a84b9ea3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11466
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1733"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=1
FT   CDS             join(367..466,5001..5264,9215..9496,10044..10154,
FT                   10484..10503)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1Y6MRN3"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y6MRN3"
FT                   /protein_id="SMY44015.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELGRPEAEYWNSQKDILEEKRAVPDR
FT                   MCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTMEWKAQSDSA
FT                   RSKTLTGAGGFMLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5000
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=1
FT   exon            5001..5264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=2
FT   intron          5265..9214
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=2
FT   exon            9215..9496
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=3
FT   intron          9497..10043
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=3
FT   exon            10044..10154
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=4
FT   intron          10155..10483
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=4
FT   exon            10484..11466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*05:new"
FT                   /number=5
XX
SQ   Sequence 11466 BP; 3101 A; 2539 C; 2974 G; 2852 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgagct       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     gaaaatggga ccaagaggtc ctggataacc ttggacagac aaggtttgca gagagagaag       780
     ttggcaagtg caggctcctg ggcgtgttca cgtctgcatc cagcctggag gggactcagg       840
     cagagagccc taagctggag tgtccaggct ctgaggatca ctgaggattc agtgctcacg       900
     aagaatgcct cttattcccc agggtggagc aggagcccac atcccttgga caattaagga       960
     gagaagggag ggagggggat aggttttagc ccctgaaggc attctcatta aaggtacttc      1020
     tcccagcctc cccagaactt ggttagggta ctagagtggg ttgcgacttg taggaagaat      1080
     gagatgaggt tgtgtgggtg catgacaggg attgagtgta ggttatcaga cagccaagga      1140
     agcagtaacc aagtgaaaaa tctcttcttc ctgctgcctc cctgtggctg gtgtaatatt      1200
     atggcatcta tgatccattg tttttctctc aggatactct caggatattt ctttttatat      1260
     atatatatac tttaagttct agggtacatg tgcacaacgt gcaggtttgt tacatatgta      1320
     tacatgtgcc atgttggtgt gctgcaccca ttaactcgtc atttacatta ggtatatttc      1380
     ctaatgctat ccctcccccc tccccccacc ccacaacagg ccccggtgta tgatgttccc      1440
     cttcctgtgt ccatgtgttc tcattgttca gttcccacct atgagtgaga acatgtggtc      1500
     tttggttttt tgtccttgca atagtttgct gtgaatgatg gtttccagct tcctccatgt      1560
     ccctacaaag gacatgaact catccttttt tatggctgca cagtattcca tggtgtatat      1620
     gtgtgcattt tcttaatcca gtctatcact gatggacagt tgggttggtt ccaagtcttt      1680
     gctattgtga atagtgccgc aataaacaca tgtgtgcatg tgtctttata gcagcatgat      1740
     ttataatcct ttgggtatat acccagtaat gggatggctg ggtcaaatgg tatttctagt      1800
     tctagatcct tgaggaattg ccacaatgtc ttgagatacc atctcacacc agttaaaatg      1860
     gcgatcatta aaaagtcagg aaacaacagg tgctggagag gatgtggaga aataggaaca      1920
     cttttactct gttggtggga ctgtaaacta gttcaaccat tgtactctca ggacatttct      1980
     agtccaaatt tacaccaaca ctctgagagg aaggactgca aagtaggtac cttagttttc      2040
     cactgacttc cacctttcct gcttacaccc ttcctcctag acccctccac acccctccta      2100
     ggacacacct agaaggtact gacatcatgt cacctcctca tctttcaggg tagcaaggtt      2160
     ggaatctcct gaatacagcc cctcaagccc taaaacctct tatctattac cttgggttca      2220
     ttgtccagga aggggaggag aacttgaact tgtagtcaca gaagggtgct gagaactaac      2280
     cagcaggacg gctcagccct gggaactgca gaggggtgag gctggggaga gaggaggctg      2340
     gagcagcact ggtgacactg aacagtgtca ggaggaggtg acggatgcgg catccccatc      2400
     ccataggcag agctgtcatg tgggatgagg gacagtgttg ggagccacca aggaaaccca      2460
     gaggtggggg agcagagagc agaagggggc atgtgatgct gggcagtgaa agggaggaca      2520
     ggcaaaggct gggttgaggt ttgtaggggg aatgagatga ggcagtggag ccatgtgaca      2580
     gggactgagg gtagattact ggagctccct gcgtagaatg aatgttcaat caaaacctgc      2640
     tggagggaga gctggagcca taggggagtg ggtaaagtgg gcagggctga ttccacaatt      2700
     ccctgcatgc tcccccaact ccacacacat ccccaacctc aaacagggca caagaccaaa      2760
     gggctgagga gccaggctat agcttaaaga ggctggggga gaaaagcttg gctgagacaa      2820
     cccataggga gctagaggtt tttaatatat cctattctga ataagagacg aattcattca      2880
     gatcagtggt ttcaaaccgt gctctgggca actcaattgc taagggttcc acaaacagga      2940
     taaagtttct tatatacaaa aaaaatgaag gtttcaaatt acaccataaa acccctcatt      3000
     gcttatgtct acttggcagg taaaattcca tttcaaaagt taaatgtact taaaaaatta      3060
     cctaagactg ggtaaattaa aaaaattaaa tgttgcaaag aaaaaattca aaattcttat      3120
     tcttgaatga aaaacgttct cttactggtg attgaggagg agaaacaaag actaacaaat      3180
     gaaaatggga gaatccacac tcagagtggg gcaattgaac aggcaggggc ggatggatgg      3240
     cagaggagga ggaatctgga ctcaaggagc tggggggctc tgggcctgga attttagggt      3300
     ctggggccca aggcaccagg agaagaggca ggtcaggata tctgagtcaa gacctgggat      3360
     cttgccttag caatgacact ggagactaaa ggtggactcc atggtgccct tgagcccagc      3420
     cctaccccat ctccactatc ctctgccacc agctgtgcaa cttctgctag gggtgaggtt      3480
     aataaactgg agaagttaat ttgtggagca tgaaacagat gagcagaaca atcacagcac      3540
     cttaatttcc ccagtgtgcc caagaacaga gcaggcctga agacactcaa acagaaacaa      3600
     acatgtgccg tgtcactgat aattctgtgt agacacacac ctgccagaca ctgctcatgg      3660
     cactccctag gaagaacagc atgtgggaaa ggctgccaaa attgttcatg taaaaattac      3720
     atcaatgctg tcttcctcgg tgctgcctat gcagctggca gccatctctt cctccacatc      3780
     atggcctccc tcagactcct catgaaggat aagatcctca aaaagaggac caacaagttc      3840
     atgaggcacc aatcagactg aaatgtcaaa attaagcata actggcggaa acccagaggt      3900
     cttaacagta gggttcgtag aaggtccaag ggccagatct tgatgcccaa cattgcttat      3960
     gggagcaaca acaacaacaa aaaacacatg ctgcccagtg gcttccagaa gtttctggcc      4020
     cacagcctca aggagctgaa agtgctgctg atgtgcaaca aatcttactg tgctgagatc      4080
     gctcacaaaa tttcctccag aactgcaaag tcatcatgga aagagtcacc cagccggcca      4140
     tcagagtcac caaccccagt accagggtgc acagctaaga aaatgagtag aaagttcatg      4200
     tccacgtttt gtgtgtaaat aaaaccataa aaactgccaa aaaaattaca tcaatgcctc      4260
     taaacccaaa ggactctacc cccacaggtc cctggttgtt gtggtgattt tcattgtgta      4320
     aaatactttc cacatctttt gacaccaagt ctttctgcag ccatgtttga aaattaactt      4380
     tcaggctaca gagtctttct tataccaaag ttgaagaaag ttttaagaaa tatatttcta      4440
     catctcctac atgcaaaaca acaggagcaa gttgaggaat tctcaagaaa ctggtcgaga      4500
     agagagagcg cttagctatg gaaaagagaa agaaggaagg gagggcttcc tggaggaggt      4560
     ggcatttgaa ccaggactga catcaggatg gaaatgtcag tcagggagtt aagtaggggg      4620
     aggagctccg ccctccacgt ccccagctcc tcccgcccct gttttttctc ccagtgaccc      4680
     cacgtgaaac gtctccgcct cctccagcca ccagcagaag ggactgcctt cccctcagtg      4740
     ctcgcccctc cctagtgatc actcagtgcc cctgagctca ttcttttcag taaattctct      4800
     ctctgcgtgg tgagaaaaca ggcctggaga ggctctgcga cccgcttagg accacagaac      4860
     tcggtactag gaaaactcct attttaaaat ccagccctgg gtgggaagat ttgggaagaa      4920
     tcgttaatat tgagagagag agggagaaag aggattagat gagagtggcg cctccgctca      4980
     tgtccgcccc ctccccgcag agaattacct tttccaggga cggcaggaat gctacgcgtt      5040
     taatgggaca cagcgcttcc tggagagata catctacaac cgggaggagc tcgtgcgctt      5100
     cgacagcgac gtgggggagt tccgggcggt gacggagctg gggcggcctg aggcggagta      5160
     ctggaacagc cagaaggaca tcctggagga gaagcgggca gtgccggaca ggatgtgcag      5220
     acacaactac gagctggacg aggccgtgac cctgcagcgc cgaggtgagt gagggctttg      5280
     ggccgggggt cccagggcag ccccgcgggc ccgtgcccag ggcgcaggag cagccgggtt      5340
     ggcctaaggg accttagtgc cgggcggaaa ggggactttg ggttggggat tcatgggggg      5400
     agcccatctg gagcttgtca ggggagcgag cgcggggacc tggactgggc tgagcatgga      5460
     gtgaggagga cgggagcaga gagaccccgg ggacttcatc aggcctggca gctgactgca      5520
     tgtggggtga aaaaaggaag ccacaggaca gcgcacaagg gtatggtgtg gagatggagg      5580
     tggagatggc acagcaggcc acacagagaa gaaacctaca gggaggtagc tgggtttgag      5640
     gtgcttgagg ggcagatggg tggtctgatg ggcaggtaga cagaagggtc tgcagccggg      5700
     gaggagactg agatacatga gaccatccag ggagagggga cccaggggga agagcaaagg      5760
     actggatcct gggaactgga cagttgtgat ttggccaaga cagaaaagcc tgtgaaagag      5820
     accaaaaaaa cccaagtgca gtgtgaggag aggcccgcag ggaagagtct tggaagctga      5880
     ggggaggtga cctcagcagc acagtggaca gcggtgccag tgacttggga aggtcggaaa      5940
     acagaagatg gaaagtgggt ttggaaacca gggagacctg gggagagcag gttggccgca      6000
     gcggcaggag ctggaatggg agggggtgca tgaggctgag tgtggcgcat cctcctcggg      6060
     gctgagatgg attttacttg tcttgggttc cccacggctg tcacagggca gtgtctcagt      6120
     tcattcgtct ttttccttca ggaagtctgg gtgtaaaggg atggagagag gtgaggtgtg      6180
     tgcagtaaga ggatttctca aggatgggac aggaaggcct tggagctttg gcttcctcct      6240
     gtgaacttgt ggggtgggga gcctggtgca ccaacctgag ggacttgagg gagtagtatc      6300
     aggatgtggg attgagccct ggaccttttt tctagaaaga ggaaaaaaat gaagggagga      6360
     ggaggaggaa gctggggaga tcacaccttt gattttcttg ttcctggaaa gtgaaaggaa      6420
     gttcacctgc tatgagtgag aaggtggaca cactgggtgg ggatgaggtg agtgatatga      6480
     gcttaggaaa gttgctgagg taattggttg agagaggtgt tcaaataaaa gtaatgcaat      6540
     tggcaaaaac tgttactaag actttgtaga ggcacaaatc agtgacatgg cagcatcttc      6600
     tttcacagta atcaactgcc agattgcagg gagccctgat accagcctaa ggagtgtgag      6660
     tttctcctct aggcccacag gtccccaacc tcactcctcc gaagactctc ctggagatca      6720
     tctgtgatgc gcagataccc agactcactg ccccgagact cagattccct gggtagggag      6780
     gtcgggggat ctctgcttgt aatcagctcc ctagaggttc ccatgtagcc ggataagtat      6840
     tgtcagaaca ctgaagattt ttgaaaaatg aaaaagagaa ggttggagat gtgtcttcag      6900
     aagactacta agggtgctag gtagaggagg gaccagaggc agggagatga ggtaggaaac      6960
     tgctattatt tgtcagggaa attgcaatca agaaatgagt tagaacaggg aaaacacaga      7020
     ggcaggggag aggtggaagg gggaggaaag gagtagtgac aattccaggg tgtatgctca      7080
     cccaaatcta gaagtaattg agcaaatgtt ttctgggcat tagagaaggc aactagaaca      7140
     aacaggaatc cttgccttgg tgaaatgtat ttgaactggg tcagaaatga ggccattggg      7200
     tatcaagcct taactccagc gccccctgga ggtcgctgat gtggctccag gctgacctgc      7260
     tcctgtcaaa gaatattgag caagatgcct ctcatggaat gttctgggac cttaaaacag      7320
     atacccaagt attccccctg atttcatggt tcccagaagc tctatgggga agaaattgta      7380
     cgtaattcac aactgagatt tagacataag ttgaatagtg taatggacgt tgagttaacc      7440
     gaggtaatga agtagtgaga cacaggtgcc cctgaaataa actcacattg agggaagagg      7500
     ctgacaatgt ggatcagtct gtaaacaagg caaaaataca atagggagta agggttgtgt      7560
     gtcagttcaa gactgtactt ttacctggcc cagcgccatg ttggggtatt tgtgttctcc      7620
     aggaagtaga aaggaaagaa ctgagtgatt agggacctag aagactaatt tgagacattc      7680
     ctcttgatga actgttctct agggtagtcc tctgaaagag ctgttctcta gtggatctcc      7740
     ctgaatgaac tgttctctag gagcacttga cccttttctg tgtttgtttt ttgttttgtg      7800
     tttgtgtttg tttttgagac aggttctcgc tctgtctccc aggctggagt gctgtggcgc      7860
     catcatgact cactgcagcc tcaacctcct gggctcaagt gatcctcctg cctcagcctc      7920
     ccatgtagct agaactacag atacatgtac caccatgtct ggctaattta tttttctttt      7980
     tagagatggg ttctcactat gttgcccagg ctggtctcga aaccctgggc tcaagtgatc      8040
     ctcacgcctc agcctcccaa agtgctaaga ttataggcat gaccaccatg cctggccttt      8100
     tctgccttcc gagaaggaaa aaggtactgg tggcagagat ccaaaagaaa agttgccagt      8160
     ggcagtgtgg aaattgacct gagaacaaca gaacaagctg gggcacaaat gcaaagatgc      8220
     agagggaggc aacatctggt tatctgtgag accttcatgg gacctgaaga cacatccttt      8280
     tggaaaagga tgggatttct actactcaag catgtagggg ctcaggatat tatgtaaata      8340
     tgaagatttt gagtttttgt aagtgaggta aaaaaaatac ctaggttatt tacagaataa      8400
     gacatgtcaa gctctcttca ttttctttgt attttcatga aataaaggta ttagattaac      8460
     aggccaccat aatgccattg tctgtatatc ttaatttcaa gatattattt gagtaatttt      8520
     tgcatccttt gtatcaagat agaactttga aaagacaggt aatttcacag ttgattaaat      8580
     attctttgcc caaattactt ttggttaaaa tttctcctat atgtgctaca gagtgcaaac      8640
     tctgtctccc tgccattccg ctatatactt actaattatt attttattca agatcatgca      8700
     tgctctactt gaaggtctat cttttcagtg ctacccttac ccactagcct aatcacatta      8760
     tatctatttt caacatctag gaatcaatta cgtagtgaac atgcctaaga aataataatc      8820
     tgggcagatg cagtggctca ggcctgtaat cccagcactt tgagaggctg agcgggtgga      8880
     tcacttgagg tcaggagttg gtcaagtgct cctagagaac cagcctgacc aacatggaga      8940
     aaccttgtct ctactgataa tacaaaaatt agccaggtga ggtggcaggc acctataatc      9000
     ccagctattc gggaggctga ggaaggagaa ttgcttgaac ccctgaggtg gaggttgcag      9060
     tgagccaata ttgcgccact gcattccaga cttggcaaca gagcgacact ccacctcaac      9120
     aaaaagaaag aaagagcgag attacgtctc aaaaaaggaa ggaaggaagg acaatctcaa      9180
     atgctatttc attattttcc ttccccactc gtagtccagc ctaaggtgaa cgtttccccc      9240
     tccaagaagg ggcccctgca gcaccacaac ctgcttgtct gccacgtgac agatttctac      9300
     ccaggcagca ttcaagtccg atggttcctg aatggacagg aggaaacagc tggggtcgtg      9360
     tccaccaacc tgatccgtaa tggagactgg accttccaga tcctggtgat gctggaaatg      9420
     accccccagc agggagacgt ctacatctgc caagtggagc acaccagcct ggacagtcct      9480
     gtcaccatgg agtggagtga gtctctgatg accgtctaga ccccacctct gaagagcagg      9540
     ggactctctg gctctggggt ccactcatct tatcttctgt atctataccc tggggccatg      9600
     tccaaacctc atctttcttc tataccagct cctgagcata gtttgaagcc agggcaatgg      9660
     agacttcctg accttggctt aggggttcct gaagattcat agttctcccc cttgtcagag      9720
     aatctaggga cactggctga tctcgaaacc ctcacacaca ggaactgacc tcacacatag      9780
     gaacagttct cttctttcag cattttagcc tcttctcagg cattttgaga ggcaacttct      9840
     agaatcagca tttgccacct tgttgaggtc acacccctgt tccggacatg agggtggctc      9900
     tttctgaatt tcctcttagc aagctttttc ccctgcactg tcttcatccc gatattctgc      9960
     atcacgctcc agaatctcag acaggacatg agtagggatg cagctggtgg aggtgacact     10020
     aaacctgggt ctgtccttcc cagaggcaca gtctgattct gcccggagta agacattgac     10080
     gggagctggg ggcttcatgc tggggctcat catctgtgga gtgggcatct tcatgcacag     10140
     gaggagcaag aaaggtgaga aagcctgcaa ggtgagcggg acttaccttc ccctggcata     10200
     ttcacactta ctccatgatg agggttcaga cagaaaagaa atgtcagaaa gctctagaga     10260
     ccactgaaat cagatagtcg gggaacaaac atgacctatg gcgagagggg gatcccaggc     10320
     tgggatctta attcagccag atgcatgagg tcccaggtgc tcagactcct gcggggcatc     10380
     cattgagtgg tggtcaatgg aatttggtgg gatggaaatg tttctctaac tatctgaggt     10440
     ggtttcaatg gctgaataca taacctttcc tctttcattt cagttcaacg aggatctgca     10500
     taaacaggta atattcctgc tttgatttcc ttggggggtg ggttacagga ggatatgact     10560
     cttttctgtg cattgtaata ctgaggctcc tccaggaagg gaatctcagg catgaacccc     10620
     tctttcaacc tcagctctcg ggtgagtggg gaaaaagcat tgcacggctc cattgctgaa     10680
     ggaagcagag atcagttctg ttctttatca gcctaagatg cagcctctca ccataatttt     10740
     tctctcctgg acttaaagga aggaggccag caacctggga taacttgtcc tttaccccca     10800
     cagggttcct gacctcaccg aaaagactaa tgtgccttag aacaagcatt tgctgtgttt     10860
     tgttagcacc tggttccagg acagaccctc agcttcccaa gaggatactg ctgccaagaa     10920
     gttgctctga agtcagtttc tatcgttctg ctctttgatt caaagcactg tttctctcac     10980
     tgggcctcca accatgttcc cttcttctta gcaccacaaa taatcaaaac ccaacataag     11040
     tgtttgtttt cctttaaaaa tatgcatcaa atcgtctctc attacttttc tctgagggtt     11100
     ttagtaaaca gtaggagtta ataaagaagt tcattttggt ttacacgtag gaaagaagag     11160
     aagcatgaaa gtggagatat gttaactatt gtataatgtg gcctgttata catgacactc     11220
     ttctgaattg actgtatttc agtgagctgc ccccaaatca agtttagtgc cctcatccat     11280
     ttatgtctca gaccgctatt cttaactatt caatggtgag cagactgcaa atctgcctga     11340
     taggacccgt attcccacag cactaattca acatatatct tactgagagc atgttttatc     11400
     attaccatta agaagttaaa tgaacatcag aatttaaaat cataaatata atctaataca     11460
     ctttaa                                                                11466
//