Dbfetch

ID   LT882756; SV 2; linear; genomic DNA; STD; HUM; 11468 BP.
XX
AC   LT882756;
XX
DT   09-JUN-2017 (Rel. 133, Created)
DT   15-AUG-2017 (Rel. 133, Last updated, Version 3)
XX
DE   Homo sapiens, HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1731, allele HLA-DPB1*01:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11468
RA   Albrecht V.;
RT   ;
RL   Submitted (06-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; ae547a042b65d1096f1da2c4e2106b3b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11468
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1731"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=1
FT   CDS             join(367..466,5002..5265,9217..9498,10046..10156,
FT                   10486..10505)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1Y6MRP3"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y6MRP3"
FT                   /protein_id="SMY44013.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQGQQECY
FT                   AFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDR
FT                   VCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   QSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5001
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=1
FT   exon            5002..5265
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=2
FT   intron          5266..9216
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=2
FT   exon            9217..9498
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=3
FT   intron          9499..10045
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=3
FT   exon            10046..10156
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=4
FT   intron          10157..10485
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=4
FT   exon            10486..11468
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*01:new"
FT                   /number=5
XX
SQ   Sequence 11468 BP; 3116 A; 2541 C; 2962 G; 2849 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgagct       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     gaaaatggga ccaagaggtc caggataacc ttggacagac aaggtttgca gagagagaag       780
     ttggcaagtg caggctcctg ggcgtgttca catctgcatc cagcctggag gggactcagg       840
     cagagagccc taagctggag tgtccaggct ctgaggatca ctgaggattc agtgctcacg       900
     aagaatgcct cttattcccc agggtggagc aggagcccac accccttgga caattaagga       960
     gagaagggag ggagggggat aggttttagc ccctgaaggc attctcatta aaggtacttc      1020
     tcccagcctc cccagaactt ggttagggta ctagagtggg ttgcgacttg taggaagaat      1080
     gagatgaggt tgtgtgggtg catgacaggg attgagtgta ggttatcaga cagccaagga      1140
     agcagtaacc aagtgaaaaa tctcttcttc ctgctgcctc cctgtggctg gtgtaatatt      1200
     atggcatcta tgatccattg tttttctctc aggatactct caggatattt ctttttatat      1260
     atatatatac tttaagttct agggtacatg tgcacaacgt gcaggtttgt tacatatgta      1320
     tacatgtgcc atgttggtgt gctgcaccca ttaactcgtc atttacatta ggtatatttc      1380
     ctaatgctat ccctcccccc tccccccacc ccacaacagg ccccggtgta tgatgttccc      1440
     cttcctgtgt ccatgtgttc tcattgttca gttcccacct atgagtgaga acatgtggtc      1500
     tttggttttt tgtccttgca atagtttgct gtgaatgatg gtttccagct tcctccatgt      1560
     ccctacaaag gacatgaact catccttttt tatggctgca cagtattcca tggtgtatat      1620
     gtgtgcattt tcttaatcca gtctatcact gatggacagt tgggttggtt ccaagtcttt      1680
     gctattgtga atagtgccgc tataaacata tgtgtgcatg tgtctttata gcagcatgat      1740
     ttataatcct ttgggtatat acccagtaat gggatggctg ggtcaaatgg tatttctagt      1800
     tctagatcct tgaggaattg ccacaatgtc ttgagatacc atctcacacc agttaaaatg      1860
     gcgatcatta aaaagtcagg aaacaacagg tgctggagag gatgtggaga aataggaaca      1920
     cttttactct gttggtggga ctgtaaacta gttcaaccat tgtactctca ggacatttct      1980
     agtccaaatt tacaccaaca ctctgagagg aaggactgca aagtaggtac cttagttttc      2040
     cactgacttc cacctttcct gcttacaccc ttcctcctag acctctccac acccctccta      2100
     ggacacacct agaaggtact gacatcatgt cacctcctca tctttcaggg tagcaaggtt      2160
     ggaatctcct gaatacagcc cctcaagccc taaaacctct tatctattac cttgggttca      2220
     ttgtccagga aggggaggag aacttgaact tgcagtcaca gaagggtgct gagaactaac      2280
     cagcaggacg gctcagccct gggaactgca gaggggtgag gctggggaga gaggaggctg      2340
     gagcagcact ggtgacactg aacagtgtca ggaggaggtg acggatgcag cgcccccatc      2400
     ccataggcag agctgtcatg tgggatgagg gacagtgttg ggagccacca aggaaaccca      2460
     gaggtggggg agcagagagc agaagggggc atgtgatgct gggcagtgaa agggaggaca      2520
     ggcaaaggct gggttgaggt ttgtaggggg aatgagatga ggcagtggag ccatgtgaca      2580
     gggactgagg gtagattact ggagctccct gcgtagaatg aatgttcaat caaaacctgc      2640
     tggagggaga gctggagcca taggggagtg ggtaaagtgg gcagggctga ttccacaatt      2700
     ccctgcatgc tcccccaact ccacacacat ccccaacctc aaacagggca caagaccaaa      2760
     gggctgagga gccaggctat agcttaaaga ggctggggga gaaaagcttg gctgagacaa      2820
     cccataggga gctagaggtt tttaatatat cctattctga ataagagacg aattcattca      2880
     gatcagtggt ttcaaaccgt gctctgggca actcaattgc taagggttcc acaaacagga      2940
     taaagtttct tatatacaaa aaaaatgaag gtttcaaatt acaccataaa acccctcatt      3000
     gcttatgtct acttggcagg taaaattcca tttcaaaagt taaatgtact taaaaaatta      3060
     cctaagactg ggtaaattaa aaaaattaaa tgttgcaaag aaaaaattca aaattcttat      3120
     tcttgaatga aaaacgttct cttactggtg attgaggagg agaaacaaag actaacaaat      3180
     gaaaatggga gaatccacac tcagagtggg gcaattgaac aggcaggggc ggatggatgg      3240
     cagaggagga ggaatctgga ctcaaggagc tggggggctc tgggcctgga attttagggt      3300
     ctggggccca aggcaccagg agaagaggca ggtcaggata tctgagtcaa gacctgggat      3360
     cttgccttag caatgacact ggagactaaa ggtggactcc atggtgccct tgagcccagc      3420
     cctaccccat ctccactatc ctctgccacc agctgtgcaa cttctgctag gggtgaggtt      3480
     aataaactgg agaagttaat ttgtggagca tgaaacagat gagcagaaca atcacagcac      3540
     cttaatttcc ccagtgtgcc caagaacaga gcaggcctga agacactcaa acagaaacaa      3600
     acatgtgccg tgtcactgat aattctgtgt agacacacac ctgccagaca ctgctcatgg      3660
     cactccctag gaagaacagc atgtgggaaa ggctgccaaa attgttcatg taaaaattac      3720
     atcaacgctg tcttcctcgg tgctgcctat gcagctggca gccatctctt cctccacatc      3780
     atggcctccc tcagactcct catgaaggat aagatcctca aaaagaggac caacaagttc      3840
     atgaggcacc aatcagactg aaatgtcaaa attaagcata actggcggaa acccagaggt      3900
     cttaacagta gggttcgtag aaggtccaag ggccagatct tgatgcccaa cattgcttat      3960
     gggagcaaca acaacaacaa aaaacacatg ctgcccagtg gcttccagaa gtttctggtc      4020
     cacagcctca aggagctgaa agtgctgctg atgtgcaaca aatcttactg tgctgagatc      4080
     gctcacaaaa tttcctccag aactgcaaag tcatcatgga aagagtcacc cagccggcca      4140
     tcagagtcac caaccccagt accagggtgc acagctaaga aaatgagtag aaagttcatg      4200
     tccacgtttt gtgtgtaaat aaaaccataa aaactgccaa aaaaaattac atcaatgcct      4260
     ctaaacccaa aggactctac ccccacaggt ccctggttgt tgtggtgatt ttcattgtgt      4320
     aaaatacttt ccacatcttt tgacaccaag tctttctgca gccatgtttg aaaattaact      4380
     ttcaggctac agagtctttc ttataccaaa gttgaagaaa gttttaagaa atatatttct      4440
     acatctccta aatgcaaaac aacaggagca agttgaggaa ttctcaagaa actggtcgag      4500
     aagagagagc gcttagctat ggaaaagaga aagaaggaag ggagggcttc ctggaggagg      4560
     tggcatttga accaggactg acatcaggat ggaaatgtca gtcagggagt taagtagggg      4620
     gagcagctcc gccctccacg tccccagctc ctcccgcccc tgttttttct cccagtgacc      4680
     ccacgtgaaa cgtctccgcc tcctccagcc accagcagaa gggactgcct tcccctcagt      4740
     gctcgcccct ccctagtgat cactcagtgc ccctgagctc attcttttca gtaaattctc      4800
     tctctgcgtg gtgagaaaac aggcctggag aggctctgcg acccgcttag gaccacagaa      4860
     ctcggtacta ggaaaactcc tattttaaaa tccagccctg agtgggtaga tttgggaaga      4920
     atcgttaata ttgagagaga gagggagaaa gaggattaga tgagagtggc gcctccgctc      4980
     atgtccgccc cctccccgca gagaattacg tgtaccaggg acagcaggaa tgctacgcgt      5040
     ttaatgggac acagcgcttc ctggagagat acatctacaa ccgggaggag tacgcgcgct      5100
     tcgacagcga cgtgggggag ttccgggcgg tgacggagct ggggcggcct gctgcggagt      5160
     actggaacag ccagaaggac atcctggagg agaagcgggc agtgccggac agggtatgca      5220
     gacacaacta cgagctggac gaggccgtga ccctgcagcg ccgaggtgag tgagggcttt      5280
     gggccggcgg tcccagggca gccccgcggg cccgtgccca gggcgcagga gcagccgggt      5340
     tggcctaagg gaccttagtg ccgggcggaa aggggacttt gggttgggga ttcatggggg      5400
     gagcccatct ggagcttgtc aggggagcga gcgcggggac ctggactggg ctgagcatgg      5460
     agtgaggagg acgggagcag agagaccccg gggacttcat caggcctggc agctgactgc      5520
     atgtgggatg aaaaaaagga agccacagga cagcgcacaa gggtatggtg tggagatgga      5580
     ggtggagatg gcacagcagg ccacacagag aagaaaccta cagggagtta gctgggtttg      5640
     aggtgcttga ggggcagatg ggtggtctga tgggcaggta gacagaaggg tctgcagccg      5700
     gggaggagac tgagatacat gagaccatcc agggagaggg gacccagggg gaagagcaaa      5760
     ggactggatc ctgggaactg gacagttgtg atttggccaa gacagaaaag cctgtgaaag      5820
     agaccaaaaa aacccaagtg cagtgtgagg agaggcccgc agagaagagt cttggaagct      5880
     gaggggaggt gacctcagca gcacagtgga cagcggtgcc agtgacttgg gaaggtcaga      5940
     aaacagaaga tggaaagtgg gtttggaaac cagggagacc tggggagagc aggttggccg      6000
     cagcggcagg agctggaatg ggagggggtg catgaggctg agtgtggcgc atcctcctcg      6060
     gggctgagat ggattttact tgtcttgggt tccccacggc tgtcacaggg cagtgtctga      6120
     gttcattcgt ctttttcctt caggaagtct gggtgtaaag ggatggagag aggtgaggtg      6180
     tgtgcagtaa gaggatttct caaggatggg acaggaaggc cttggagctt tggcttcctc      6240
     ctgtgaactt gtggggtggg gagcctggtg caccaacctt tgggacttga gggagtagta      6300
     tcaggatgtg ggattgagcc ctggaccttt tttctagaaa gaggaaaaaa atgaagggag      6360
     gaggaggagg aagctgggga gatcacacct ttgattttct tgttcctgga aagtgaaagg      6420
     aagttcacct gctaggagtg agaaggtgga cacacagggt ggggatgagg tgagtgacat      6480
     gagcttagga aagttgctga ggtaattggt tgagagagat gttcaaataa aagtaatgca      6540
     attggcaaaa actgttacta agactttgta gaggcacaaa tcagtgacat ggcagcatct      6600
     tctttcacag taatcaactg ccagattgca gggagcactg ataccagcct aaggagtgtg      6660
     agtttctcct ctaggcccac aggtccccaa cctcactcct ccgaagactc tcctggagat      6720
     catctgtgat gtgcagatac ccagactcac tgccccgaga ctcagattcc ctgggtaggg      6780
     aggtcggggg atctctgctt gtaatcagct ccctagaggt tcccatgtag ccggataagt      6840
     attgtcagaa cactgaagat ttttgaaaaa tgaaaaagag aaggttggag atgtgtcttc      6900
     agaagactac taagggtgct gggtagagga gggaccagag gcagggagat gaggtaggaa      6960
     actgctatta tttgtcaggg aaattgcaat caagaaatga gttagaacag ggaaaacaca      7020
     gaggcagggg agaggtggaa gggggaggaa aggagtagtg acaattccag ggtgtatgct      7080
     cacccaaatc tagaagtaat tgagcaaatg ttttctgggc attagagaag gcaactagaa      7140
     caaacaggaa tccttgcctt ggtgaaatgt atttgaactg ggtcagaaat gaggccattg      7200
     ggtatcaagc cttaactcca gcgccccctg gaggtcgctg atgtggctcc aggctgacct      7260
     gctcctgtca aagaatattg agcaagatgc ctctcatgga atgttctggg accttaaaac      7320
     agatacccaa gtattccccc tgatttcatg gttcccagaa gctctatggg gaagaaattg      7380
     tacgtaattc acaactgaga tttagacata agttgaatag tgtaatggac gttgagttaa      7440
     ccgaggtaat gaagtagtga gacacaggtg cccctgaaat aaactcacat tgagggaaga      7500
     ggctgacaat gtggatcagt ctgtaaacaa ggcaaaaata caatagggag taagggttgt      7560
     gtgtcagttc aagactgtac ttttacctgg cccagcgcca tgttggggta tttgtgttct      7620
     ccaggaagta gaaaggaaag aactgagtga ttagggacct agaagactaa tttgagacat      7680
     tcctcttgat gaactgttct ctagggtagt cctctgaaag agctgttctc tagtggatct      7740
     ccctgaatga actgttctct aggagcactt gacccttttc tgtgtttgtt ttttgttttg      7800
     tgtttgtgtt tgtttttgag acaggttctc gctctgtctc ccaggctgga gtgctgtggc      7860
     gccatcatga ctcactgcag cctcaacctc ctgggctcaa gtgatcctcc tgcctcagcc      7920
     tcccatgtag ctagaactac agatacatgt accaccatgt ctggctaatt tatttttctt      7980
     tttagagatg ggttctcact atgttgccca ggctggtctc gaaaccctgg gctcaagtga      8040
     tcctcacgcc tcagcctccc aaagtgctaa gattataggc atgaccacca tgcctggcct      8100
     tttctgcctt ccgagaagga aaaaggtact ggtggcagag atccaaaaga aaagttgcca      8160
     gtggcagtgt ggaaattgac ctgagaacaa cagaacaagc tggggcacaa atgcaaagat      8220
     gcagagggag gcaacatctg gttatctgtg agaccttcat gggacctgaa gacacatcct      8280
     tttggaaaag gatgggattt ctactactca agcatgtagg ggctcaggat attatgtaaa      8340
     tatgaagatt ttgagttttt gtaagtgagg taaaaaaaat acctaggtta tttacagaat      8400
     aagacatgtc aagctctctt cattttcttt gtattttcat gaaataaagg tattagatta      8460
     acaggccacc ataatgccat tgtctgtata tcttaatttc aagatattat ttgagtaatt      8520
     tttgcatcct ttgtatcaag atagaacttt gaaaagacag gtaatttcac agttgattaa      8580
     atattctttg cccaaattac ttttggttaa aatttctcct atatgtgcta cagagtgcaa      8640
     actctgtctc cctgccattc cgctatatac ttactaatta ttattttatt caagatcatg      8700
     catgctctac ttgaaggtct atcttttcag tgctaccctt acccactagc ctaatcacat      8760
     tatatctatt ttcaacatct aggaatcaat tacgtagtga acatgcctaa gaaataataa      8820
     tctgggcaga tgcagtggct caggcctgta atcccagcac tttgagaggc tgagcgggtg      8880
     gatcacttga ggtcaggagt tggtcaagtg ctcctagaga accagcctga ccaacatgga      8940
     gaaaccttgt ctctactgat aatacaaaaa ttagccaggt gaggtggcag gcacctataa      9000
     tcccagctat tcgggaggct gaggaaggag aattgcttga acccctgagg tggaggttgc      9060
     agtgagccaa tattgcacca ctgcattcca gacttggcaa cagagcgaca ctccacctca      9120
     acaaaaagaa agaaagagcg agattacgtc tcaaaaaagg aaggaaggaa ggacaatctc      9180
     aaatgctatt tcattatttt tcttccccac tcgtagtcca gcctaaggtg aacgtttccc      9240
     cctccaagaa ggggcccctg cagcaccaca acctgcttgt ctgccacgtg acagatttct      9300
     acccaggcag cattcaagtc cgatggttcc tgaatggaca ggaggaaaca gctggggtcg      9360
     tgtccaccaa cctgatccgt aatggagact ggaccttcca gatcctggtg atgctggaaa      9420
     tgacccccca gcagggagac gtctacatct gccaagtgga gcacaccagc ctggacagtc      9480
     ctgtcaccgt ggagtggagt gagtctctga tgaccatcta gaccccacct ctgaagagca      9540
     ggggactctc tggctctggg gtccactcat cttatcttct gcatctatac cctggggcca      9600
     tgtccaaacc ccatctttct tctataccag ctcctgagca tagtttgaag ccagggcaat      9660
     ggagacttcc tgaccttggc ttaggggttc ctgaagattc atagttctcc cccttgtcag      9720
     agaatctagg gacactggct gatctcgaaa ccctcacaca caggaactga cctcacacat      9780
     aggaacagtt ctcttctttc agcattttag cctcttctca ggcattttga gaggcaactt      9840
     ccagaatcag catttgccac cttgttgagg tcacacccct gttccagaca tgagggtggc      9900
     tctttctgaa tttcctctta gcaagctttt tcccctgcac tgtcttcatc ccgatattct      9960
     gcatcacgct ccagaatctc agacaggaca tgagtaggga tgcagctggt ggaggtgaca     10020
     ctaaacctgg gtctgtcctt cccagaggca cagtctgatt ctgcccagag taagacattg     10080
     acgggagctg ggggcttcgt gctggggctc atcatctgtg gagtgggcat cttcatgcac     10140
     aggaggagca agaaaggtga gaaagcctgc aaggtgagcg ggacttacct tcccctggca     10200
     tattcacact tactccatga tgagggttta gacagaaaag aaatgtcaga aagctctaga     10260
     gaccactgaa atcagatagt cggggaacaa acatgaccta tagcgagagt gggatcccag     10320
     gctgggatct taatgcagcc agatgcatga ggtcccaggt gctcagactc ctgcggggca     10380
     tccattgagt ggtggtcaat ggaatttggt gggatggaaa tgtttctcta attatctgag     10440
     gtggtttcaa tggctgaata cataaccttt cctctttcat ttcagttcaa cgaggatctg     10500
     cataaacagg taatattcct gctttgattt ccttgggggg tgggttacag gaggatatga     10560
     ctcctttctg tgcattgtaa tactgaggct cctccaggaa gggaatctca ggcatgaacc     10620
     cctctttcaa cctcagctct cgggtgagtg gggaaaaagc attgcacggc tccattgctg     10680
     aaggaagcag agatcagttc tgttctttat cagcctaaga tgcagcctct caccataatt     10740
     tttctctcct ggacttaaag gaaggaggcc agcaacctgg gataacttgt cctttacccc     10800
     cacagggttc ctgacctcac cgaaaagact aatgtgcctt agaacaagca tttgctgtgt     10860
     tttgttaaca cctggttcca ggacagaccc tcagcttccc aagaggatac tgctgccaag     10920
     aagttgctct gaagtcagtt tctatcgttc tgctctttga ttcaaagcac tgtttctctc     10980
     actgggcctc caaccatgtt cccttcttct tagcaccaca aataatcaaa acccaacata     11040
     agtgtttgct ttcctttaaa aatatgcatc aaatcgtctc tcattacttt tctctgaggg     11100
     ttttagtaaa cagtaggagt taataaagaa gttcattttg gtttacacgt aggaaagaag     11160
     agaagcatga aagtggagat atgttaacta ttgtataatg tggcctgtta tacatgacac     11220
     tcttctgaat tgactgtatt tcagtgagct gcccccaaat caagtttagt gccctcatcc     11280
     atttatgtct cagaccgcta ttcttaacta ttcaatggtg agcagactgc aaatctgcct     11340
     gataggaccc atattcccac agcactaatt caacatatat cttactgaga gcatgtttta     11400
     tcattaccat taagaagtta aatgaacatc agaatttaaa atcataaata taatctaata     11460
     cactttaa                                                              11468
//