Dbfetch

ID   LT882749; SV 1; linear; genomic DNA; STD; HUM; 11532 BP.
XX
AC   LT882749;
XX
DT   09-JUN-2017 (Rel. 133, Created)
DT   21-JUL-2017 (Rel. 133, Last updated, Version 2)
XX
DE   Homo sapiens, HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1724, allele HLA-DPB1*33:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11532
RA   Albrecht V.;
RT   ;
RL   Submitted (06-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; 635f71e271fc6188461c62b4c69f5967.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11532
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1724"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=1
FT   CDS             join(367..466,5003..5266,9281..9562,10110..10220,
FT                   10550..10569)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I4EC15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:I4EC15"
FT                   /protein_id="SMY44006.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5002
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=1
FT   exon            5003..5266
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=2
FT   intron          5267..9280
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=2
FT   exon            9281..9562
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=3
FT   intron          9563..10109
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=3
FT   exon            10110..10220
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=4
FT   intron          10221..10549
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=4
FT   exon            10550..11532
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*33:new"
FT                   /number=5
XX
SQ   Sequence 11532 BP; 3140 A; 2539 C; 2990 G; 2863 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgagct       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     gaaaatggga ccaagaggtc ctggataacc ttggacagac aaggtttgca gagagagaag       780
     ttggcaagtg caggctcctg ggcgtgttca tgtctgcatc cagcctggag gggactcagg       840
     cagagagccc taagctggag tgtccaggct ctgaggatca ctgaggattc agtgctcacg       900
     aagaatgcct cttattcccc agggtggagc aggagcccac atcccttgga caattaagga       960
     gagaagggag ggagggggat aggttttagc ccctgaaggc attctcatta aaggtacttc      1020
     tcccagcctc cccagaactt ggttagggta ctagagtggg ttgcgacttg taggaagaat      1080
     gagatgaggt tgtgtgggtg catgacaggg attgagtgta ggttatcaga cagccaagga      1140
     agcagtaacc aagtgaaaaa tctcttcttc ctgctgcctc cctgtggctg gtgtaatatt      1200
     atggcatcta tgatccattg tttttctctc aggatactct caggatattt ctttatatat      1260
     atatatatac tttaagttct agggtacatg tgcacaacgt gcaggtttgt tacatatgta      1320
     tacatgtgcc atgttggtgt gctgcaccca ttaactcgtc atttacatta ggtatatttc      1380
     ctaatgctat ccctcccccc tccccccacc ccacaacagg ccccggtgta tgatgttccc      1440
     cttcctgtgt ccatgtgttc tcattgttca gttcccacct atgagtgaga acatgtggtc      1500
     tttggttttt tgtccttgca atagtttgct gtgaatgatg gtttccagct tcctccatgt      1560
     ccctacaaag gacatgaact catccttttt tatggctgca cagtattcca tggtgtatat      1620
     gtgtgcattt tcttaatcca gtctatcact gatggacagt tgggttggtt ccaagtcttt      1680
     gctattgtga atagtgccgc tataaacata tgtgtgcatg tgtctttata gcagcatgat      1740
     ttataatcct ttgggtatat acccagtaat gggatggctg ggtcaaatgg tatttctagt      1800
     tctagatcct tgaggaattg ccacaatgtc ttgagatacc atctcacacc agttaaaatg      1860
     gcgatcatta aaaagtcagg aaacaacagg tgctggagag gatgtggaga aataggaaca      1920
     cttttactct gttggtggga ctgtaaacta gttcaaccat tgtactctca ggacatttct      1980
     agtccaaatt tacaccaaca ctctgagagg aaggactgca aagtaggtac cttagttttc      2040
     cactgacttc cacttttcct gcttacaccc ttcctcctag acctctccac acccctccta      2100
     ggacacacct aaaaggtact gacatcatgt cacctcctca tctttcaggg tagcaaggtt      2160
     ggaatctcct gaatacagcc cctcaagccc taaaacctct tatctattac cttgggttca      2220
     ttgtccagga aggggaggag aacttgaact tgtagtcaca gaagggtgct gagaactaac      2280
     cagcaggacg gctcagccct gggaactgca gaggggtgag gctggggaga gaggaggctg      2340
     gagcagcact ggtgacactg aacagtgtca ggaggaagtg acggatgcag cgcccccatc      2400
     ccataggcag agctgtcatg tgggatgagg gacagtgttg ggagccacca aggaaaccca      2460
     gaggtggggg agcagagagc agaagggggc atgtgatgct gggcagtgaa agggaggaca      2520
     ggcaaaggct gggttgaggt ttgtaggggg aatgagatga ggcagtggag ccatgtgaca      2580
     gggactgagg gtagattact ggagctccct gcgtagaatg aatgttcaat caaaacctgc      2640
     tggagggaga gctggagcca taggggagtg ggtaaagtgg gcagggctga ttccacaatt      2700
     ccctgcatgc tcccccaact ccacacacat ccccaacctc aaacagggca caagaccaaa      2760
     gggctgagga gccaggctat agcttaaaga ggctggggga gaaaagcttg gctgagacaa      2820
     cccataggga gctagaggtt tttaatatat cctattctga ataagagacg aattcattca      2880
     gatcagtggt ttcaaaccgt gctctgggca actcaattgc taagggttcc acaaacagga      2940
     taaagtttct tatatacaaa aaaaaatgaa ggtttcaaat tacaccataa aacccctcat      3000
     tgcttatgtc tacttggcag gtaaaattcc atttcaaaag ttaaatgtac ttaaaaaatt      3060
     acctaagact gggtaaatta aaaaaattaa atgttgcaaa gaaaaaattc aaaattctta      3120
     ttcttgaatg aaaaacgttc tcttactggt gattgaggag gagaaacaaa gactaacaaa      3180
     tgaaaatggg agaatccaca ctcagagtgg ggcaattgaa caggcagggg cggatggatg      3240
     gcagaggagg aggaatctgg actcaaggag ctggggggct ctgggcctgg aattttaggg      3300
     tctggggccc aaggcaccag gagaagaggc aggtcaggat atctgagtca agacctggga      3360
     tcttgcctta gcaatgacac tggagactaa aggtggactc catggtgccc ttgagcccag      3420
     ccctacccca tctccactat cctctgccac cagctgtgca acttctgcta ggggtgaggt      3480
     taataaactg gagaagttaa tttgtggagc atgaaacaga tgagcagaac aatcacagca      3540
     ccttaatttc cccagtgtgc ccaagaacag agcaggcctg aagatactca aacagaaaca      3600
     aacatgtgcc gtgtcactga taattctgtg tagacacaca cctgccagac actgctcatg      3660
     gcactcccta ggaagaacag catgtgggaa aggctgccaa aattgttcat gtaaaaatta      3720
     catcaatgct gtcttcctcg gtgctgccta tgcagctggc agccatctct tcctccacat      3780
     catggcctcc ctcagactcc tcatgaagga taagatcctc aaaaagagga ccaacaagtt      3840
     catgaggcac caatcagact gaaatgtcaa aattaagcat aactggcgga aacccagagg      3900
     tcttaacagt agggttcgta gaaggtccaa gggccagatc ttgatgccca acattgctta      3960
     tgggagcaac aacaacaaca aaaaaaacat gctgcccagt ggcttccaga agtttctggt      4020
     ccacagcctc aaggagctga aagtgctgct gatgtgcaac aaatcttact gtgctgagat      4080
     cgctcacaaa atttcctcca gaactgcaaa gtcatcatgg aaagagtcac ccagccggcc      4140
     atcagagtca ccaaccccag taccagggtg cacagctaag aaaatgagta gaaagttcat      4200
     gtccacgttt tgtgtgtaaa taaaaccata aaaactgcca aaaaaaatta catcaatgcc      4260
     tctaaaccca aaggactcta cccccacagg tccctggttg ttgtggtgat tttcattgtg      4320
     taaaatactt tccacatctt ttgacaccaa gtctttctgc agccatgttt gaaaattaac      4380
     tttcaggcta cagagtcttt cttataccaa agttgaagaa agttttaaga aatatatttc      4440
     tacatctcct acatgcaaaa caacaggagc aagttgagga attctcaaga aactggtcga      4500
     gaagagagag cgcttagcta tggaaaagag aaagaaggaa gggagggctt cctggaggag      4560
     gtggcatttg aaccaggact gacatcagga tggaaatgtc agtcagggag ttaagtaggg      4620
     ggagcagctc cgccctccac gtccccagct cctcccgccc ctgttttttc tcccagtgac      4680
     cccacgtgaa acgtctccgc ctcctccagc caccagcaga agggactgcc ttcccctcag      4740
     tgctcgcccc tccctagtga tcactcagtg cccctgagct cattcttttc agtaaattct      4800
     ctctctgcgt ggtgagaaaa caggcctgga gaggctctgc gacccgctta ggaccacaga      4860
     actcggtact aggaaaactc ctattttaaa atccagccct gggtgggaag atttgggaag      4920
     aatcgttaat attgagagag agagggagaa agaggattag atgagagtgg cgcctccgct      4980
     catgtccgcc ccctccccgc agagaattac cttttccagg gacggcagga atgctacgcg      5040
     tttaatggga cacagcgctt cctggagaga tacatctaca accgggagga gttcgcgcgc      5100
     ttcgacagcg acgtggggga gttccgggcg gtgacggagc tggggcggcc tgctgcggag      5160
     tactggaaca gccagaagga catcctggag gagaagcggg cagtgccgga caggatgtgc      5220
     agacacaact acgagctggg cgggcccatg accctgcagc gccgaggtga gtgagggctt      5280
     tgggccggcg gtcccagggc agccccgcgg gcccgtgccc agggcgcagg agcagccggg      5340
     ttggcctaag ggaccttagt gccgggcgga aaggggactt tgggttgggg attcatgggg      5400
     ggagcccatc tggagcttgt caggggagcg agcgcgggga cctggactgg gctgagcatg      5460
     gagtgaggag gacgagagca gagagacccc cgggacttca tcaggcctgg cagctgactg      5520
     catgtggggt gaaaaaagga agccacagga cagcgcacaa gggtatggtg tggagatgga      5580
     ggtggagatg gcacagcagg ccacacagag aagaaaccta cagggaggta gctgggtttg      5640
     aggtgcttga ggggcagatg ggtggtctga tgggcaggta gacagaaggg tctgcagccg      5700
     gggaggagac tgagatacat gagaccatcc agggagaggg gacccagggg gaagagcaaa      5760
     ggaccggatc ctgggaactg gacagttgtg atttggccaa gacagaaaag cctgtgaaag      5820
     agaccaaaaa aacccaagtg cagtgtgagg agaggcccgc agagaagagt cttggaagct      5880
     gaggggaggt gacctcagca gcacagtgga cagcggtgcc agtgacttgg gaaggtcaga      5940
     aaacagaaga tggaaagtgg gtttggaaac cagggagacc tggggagagc aggttggccg      6000
     cagcggcagg agctggaatg ggagggggtg catgaggctg agtgtggcgc atcctcctcg      6060
     gggctgagat ggattttact tgtcttgggt tccccacggc tgtcacaggg cagtgtctca      6120
     gttcattcgt ctttttcctt caggaagtct gggtgtaaag ggatggagag aggtgaggtg      6180
     tgtgcagtaa gaggatttct caaggatggg acaggaaggc cttggagctt tggcttcctc      6240
     ctgtgaactt gtggggtggg gagcctggtg caccaacctg agggacttga gggagtagta      6300
     tcaggatgtg ggattgagcc ctggaccttt tttctagaaa gaggaaaaaa atgaagggag      6360
     gaggaggagg aagctgggga gatcacacct ttgattttct tgttcctgga aagtgaaagg      6420
     aagttcacct gctatgagtg agaaggtgga cacactgggt ggggatgagg tgagtgacat      6480
     gagcttagga aagttgctga ggtaattggt tgagagaggt gttcaaataa aaataacgca      6540
     attggcaaaa actgttacta agactttgta gaggcaccaa tcagtgacat ggcagcattt      6600
     tctttcacag taatcaactg ccagattgca gacagccctg atgccagcct aaggagtgtg      6660
     ggtttctcct ccaggcccgc aggtccccaa cctcactcct ctgaagactc ttctggagat      6720
     cctctgtgat gcacagatct ccagactcag tgcccccaga ctcagattcc ctgggtgggg      6780
     aggtctgggg atctctgctt gtaatcagct ccctagaggt tcccatgtag ccagataagt      6840
     attgtcagaa cactgaagat ttttgaaaaa tgaaaaagag aaggttggag atgtgtcttc      6900
     agaagactac taagggtgct ggctagagga gggaccagag gcagggagat gaggtaggaa      6960
     actgctatta tttgtcaggg aaattgcaat caaggcatga gttagaacag ggaaaacaca      7020
     gaggcaaggg agaggtggaa gggggaggaa agaagtagtg acaattccag ggtggatgtc      7080
     cacccaaatc tagaagtaat tgagcaaatg ttttctgggc attagagaag gcaactagaa      7140
     caaacaggaa tccttgcctt ggtgaaatgt atttgaactg ggtcagaaat gaggccattg      7200
     ggtatcaggc cttaactcca gcgcaccctg gaggtcactg atgtggctcc aggctgacct      7260
     gctcctgtca aagaatattg agcaagatgc ctctcgtgga atgttctggg accttaaaac      7320
     agatacccaa gtattccccc tgatttcatg gttcccagaa gctctatggg gaagaaattg      7380
     taggtaattc acaactgaga tttagacata agttgaatag tgtaatggac attgagttaa      7440
     ccgaggtaat gaagtagtga gacacaggtg cccctgaaat aaactcacat tgagggaaga      7500
     ggctgacaat gtggatcagt ctgaaaacaa ggcaaaaata caatagggag taagggttgt      7560
     gtgtcagttc aagactgtac ttttacctgg cccagcgcca tgttagggta tttgtgttct      7620
     ccaggaagta gaaaggaaag aactgagtga ttagggacct agaagactaa tttgagacat      7680
     tcctcttgat gagctgttct ctagggtagt cctctgaaag agctgttctc tagtggatct      7740
     ccctgaatga actgttctct aggagcactt gacccttttc tgtgtttgtt ttttgttttg      7800
     tgtttgtgtt tgtttttgag acaggttctc actttgtctc ccaggctgga gtgctgtggc      7860
     accatcatgg ctcactgcag cctcaacctc ctgggctcaa gtgatcctcc tgcctcagcc      7920
     tcccatgtag ctagaactac agatacacgt accaccatgt ctggctaatt tatttttctt      7980
     tttagagatg ggttctcact atgttgccca ggccggtctc aaaaccctgg gctcaagtga      8040
     tcctcatgcc tcaacctccc aaagtgctaa gattataggc atgaccacca tgcctggcct      8100
     tttctgcttt ctgaggagga aaaaggtact ggtggcagag atccaaaaga aaagttgcca      8160
     gtggcagtgt ggaaattcac ctgagaacaa caggacaagc tggggcacaa atgcaaagat      8220
     gcagagggag gcaacacctg gtcatctgtg agaccttcat gggacctgaa gacgcagcac      8280
     agaggaggaa cttgaaaaag gacgggattt ctactactca agcatgtagg agctcaggat      8340
     attctgtaaa tatgaagatt ttgagttttt gtaggtgagg taaaaaaata cataggtttt      8400
     ttacagaata agacatgtaa agctctcttc attttctttg tattttcatg aagttattag      8460
     attcacaggc caccataatg ccattgtctg tatatcttaa tttcaagata ttatttgagt      8520
     aaattttgct tcctttgtat caagatagaa ctttgaaaag gtaggtaatt tcacagttga      8580
     tcaaatattc tttgcccaaa ttacttttgg ttaaaatttc tcctaaatgt gctacagagt      8640
     gcaaactctg tctccctgcc attccgctat atacttacta actattattt tattcaagat      8700
     catgcatgct ctacttgaag gtctatttct atcttttcaa tgctaccctt acccactagc      8760
     ctaatcacat tattcctatt ttcaacatct aggaatcaat tacatagtga acatgcctaa      8820
     gaaataataa tctgggcaga tgcagtggct caggcccgta atcccagccc tttgagaggc      8880
     cgagcgggtg gatcacttga ggtcaggcgt tggtcaagtg ctcctagaga accaggctga      8940
     ccaacatgga gaaaccttgt ctctactaat aatacaaaaa ttagccaggt gaagtggcag      9000
     gcacctataa tcccagctat tcgggaggct gaggaaggag aattggttga agcccggagg      9060
     tggaggttgc agtgagccaa tattgcgcca ctgcattcca gacttggcaa cagagtgaca      9120
     ctccatctca acaaaaagaa agaatgaaag aaagaaagag cgagattatg tctcaaaaaa      9180
     aaggaaggaa ggaaggaagg aaggaaggaa ggaaggaagg aaggaaggaa agaaggacaa      9240
     tctcaaattc tatttcatta tttttcttcc acgctcctag tccagcctag ggtgaatgtt      9300
     tccccctcca agaaggggcc cttgcagcac cacaacctac ttgtctgcca cgtgacggat      9360
     ttctacccag gcagcattca agtccgatgg ttcctgaatg gacaggagga aacagctggg      9420
     gtcgtgtcca ccaacctgat ccgtaatgga gactggacct tccagatcct ggtgatgctg      9480
     gaaatgaccc cccagcaggg agatgtctac acctgccaag tggagcacac cagcctggat      9540
     agtcctgtca ccgtggagtg gagtgagtct ctgatgaccc tctagacccc acctctgaag      9600
     agcaggggac tctctggctc tggggtccac tcatcttatc ttctgcatct ataccctggg      9660
     gccatgtcca aaccccatct ttcttctata ccagctcctg agcatagttt gaagccaggg      9720
     aaatggagac ttcctgacct tagcttaggg gttcctgaag attcatagtt ctcccccttg      9780
     tcagagaatc tagggacact gactggtctc gaaaccctca cacttaggaa ctgacctcac      9840
     acataggaac agttctcttc cttcagcatt ttagcctctt ctcaggcatt ttgagaggca      9900
     acttccagaa tcagcatttg ccaccttgtt gaggtcacac ccctgttcca gatatgaggg      9960
     tggctctttc tgaatttcct cttagcaagc tttttccgct gcactgtcct catcccgata     10020
     tgctgcatca ggctccagaa tctcagacag gacatgagta gggatgcagc tggtggaggt     10080
     gacactaaac ctgggtctgt ccttcccaga ggcacagtct gattctgccc ggagtaagac     10140
     attgacggga gctgggggct tcgtgctggg gctcatcatc tgtggagtgg gcatcttcat     10200
     gcacaggagg agcaagaaag gtgagaaagc ctgcagggtg agcgggactt accttcccct     10260
     ggcatattca cacttattcc acgatgaggg gtttgacaga aaagaaatgt cagaaagctc     10320
     tagaggccac tgatatcaga taatcgggga acaaacatga cctatagcga gagagggatc     10380
     ccaggctggg atcttaatgc agccagatgc atgaggtccc aagtactcag gctcctgcgg     10440
     agcgtccatt gagtgatggg caatggaatt tggtgggatg gaaatgtttc tctaattatc     10500
     tgaggtggtt tcaatggctg attatataac ctttcgtctt tcatttcagt tcaacgagga     10560
     tctgcataaa caggtaatat tcctgctttg atttccttgt ggggtgggtt gcaggaggat     10620
     atgagtcctt tctgtgcatt gtaacactga ggctcctcca ggaagggaat ctcaggcatg     10680
     aacccctctt tcaatgtcag ccttcaggca agtggggaaa gagcattgct tggctccatt     10740
     gctgaaggaa gcagagatca actctgttat ttatcagcct gagacgcatc ctctcaccat     10800
     aatttttctc tcctggactt acaggaagga ggctggcaac ctgggataac ttgtctttta     10860
     cccccacagg gttcctgagc tcactgaaaa gactattgtg ccttaggaaa agcatttgct     10920
     gtgtttcgtt agcatctggc tccaggacag accttcaact tccaaattgg atactgctgc     10980
     caagaagttg ctctgaagtc agtttctatc attctgctct ttgattcaaa gcactgtttc     11040
     tctcactggg cctccaacca tgttcccttc ttcttagcac cacaaataat caaaacccaa     11100
     catgactgtt tgttttcctt taaaaatatg caccaaatca tctctcatca cttttctctg     11160
     agggttttag tagacagtag gagttaataa agaagttcat tttggtttaa acataggaaa     11220
     gaagagaacc atgaaaatgg ggatatgtta actattgtat aatggggcct gttacacatg     11280
     acactcttct gaattgactg tatttcagtg agctgccccc aaatcaagtt tagtgccctc     11340
     atccatttat gtctcagacc actattctta actattcaat ggtgagcaga ctgcaaatct     11400
     gcctgatagg acccatattc ccacagcact aattcaacat ataccttact gagagcatgt     11460
     tttatcatta ccattaagaa gttaaatgaa catcagaatt taaaatcata aatataatct     11520
     aatacacttt aa                                                         11532
//