Dbfetch

ID   LT882741; SV 2; linear; genomic DNA; STD; HUM; 11461 BP.
XX
AC   LT882741;
XX
DT   09-JUN-2017 (Rel. 133, Created)
DT   15-AUG-2017 (Rel. 133, Last updated, Version 3)
XX
DE   Homo sapiens, HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1717, allele HLA-DPB1*11:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11461
RA   Albrecht V.;
RT   ;
RL   Submitted (06-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; edd92b6b8b65e45bb3bb1b00833c9e6d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11461
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1717"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=1
FT   CDS             join(367..466,5001..5264,9216..9497,10045..10155,
FT                   10485..10504)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1Y6MTA3"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y6MTA3"
FT                   /protein_id="SMY43998.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQLRQECY
FT                   AFNGTQRFLERYIYNRQEYARFDSDVGEFRAVTELGRPAAEYWNSQKDLLEERRAVPDR
FT                   MCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIHNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5000
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=1
FT   exon            5001..5264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=2
FT   intron          5265..9215
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=2
FT   exon            9216..9497
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=3
FT   intron          9498..10044
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=3
FT   exon            10045..10155
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=4
FT   intron          10156..10484
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=4
FT   exon            10485..11461
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*11:new"
FT                   /number=5
XX
SQ   Sequence 11461 BP; 3104 A; 2544 C; 2964 G; 2849 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgagct       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     aaaatgggac caagaggtcc aggataacct tggacagaca aggtttgcag agagagaagt       780
     tggcaagtgc aggctcctgg gcgtgttcac atctgcatcc agcctggagg ggactcaggc       840
     agagagccct aagctggagt gtccaggctc tgaggatcac tgaggattca gtgctcacga       900
     agaatgcctc ttattcccca gggtggagca ggagcccaca ccccttggac aattaaggag       960
     agaagggagg gagggggata ggttttagcc cctgaaggca ttctcattaa aggtacttct      1020
     cccagcctcc ccagaacttg gttagggtac tagagtgggt tgcgacttgt aggaagaatg      1080
     agatgaggtt gtgtgggtgc atgacaggga ttgagtgtag gttatcagac agccaaggaa      1140
     gcagtaacca agtgaaaaat ctcttcttcc tgctgcctcc ctgtggctgg tgtaatatta      1200
     tggcatctat gatccattgt ttttctctca ggatactctc aggatatttc tttttatata      1260
     tatatatact ttaagttcta gggtacatgt gcacaacgtg caggtttgtt acatatgtat      1320
     acatgtgcca tgttggtgtg ctgcacccat taactcgtca tttacattag gtatatttcc      1380
     taatgctatc cctcccccct ccccccaccc cacaacaggc cccggtgtat gatgttcccc      1440
     ttcctgtgtc catgtgttct cattgttcag ttcccaccta tgagtgagaa catgtggtct      1500
     ttggtttttt gtccttgcaa tagtttgctg tgaatgatgg tttccagctt cctccatgtc      1560
     cctacaaagg acatgaactc atcctttttt atggctgcac agtattccat ggtgtatatg      1620
     tgtgcatttt cttaatccag tctatcactg atggacagtt gggttggttc caagtctttg      1680
     ctattgtgaa tagtgccgct ataaacatat gtgtgcatgt gtctttatag cagcatgatt      1740
     tataatcctt tgggtatata cccagtaatg ggatggctgg gtcaaatggt atttctagtt      1800
     ctagatcctt gaggaattgc cacactgtct tgagatacca tctcacacca gttaaaatgg      1860
     cgatcattaa aaagtcagga aacaacaggt gctggagagg atgtggagaa ataggaacac      1920
     ttttactctg ttggtgggac tgtaaactag ttcaaccatt gtactctcag gacatttcta      1980
     gtccaaattt acaccaacac tctgagagga aggactgcaa agtaggtacc ttagttttcc      2040
     actgacttcc acttttcctg cttacaccct tcctcctaga cctctccaca cccctcctag      2100
     gacacaccta gaaggtactg acatcatgtc acctcctcat ctttcagggt agcaaggttg      2160
     gaatctcctg aatacagccc ctcaagccct aaaacctctt atctattacc ttgggttcat      2220
     tgtccaggaa ggggaggaga acttgaactt gtagtcacag aagggtgctg agaactaacc      2280
     agcaggacgg ctcagccctg ggaactgcag aggggtgagg ctggggagag aggaggctgg      2340
     agcagcactg gtgacactga acagtgtcag gaggaagtga cggatgcagc gcccccatcc      2400
     cataggcaga gctgtcatgt gggatgaggg acagtgttgg gagccaccaa ggaaacccag      2460
     aggtggggga gcagagagca gaagggggca tgtgatgctg ggcagtgaaa gggaggacag      2520
     gcaaaggctg ggttgaggtt tgtaggggga atgagatgag gcagtggagc catgtgacag      2580
     ggactgaggg tagattactg gagctccctg cgtagaatga atgttcaatc aaaacctgct      2640
     ggagggagag ctggagccat aggggagtgg gtaaagtggg cagggttgat tccacaattc      2700
     cctgcatgct cccccaactc cacacacatc cccaacctca aacagggcac aagaccaaag      2760
     ggctgaggag ccaggctata gcttaaagag gctgggggag aaaagcttgg ctgagacaac      2820
     ccatagggag ctagaggttt ttaatatatc ctattctgaa taagagacga attcattcag      2880
     atcagtggtt tcaaaccgtg ctctgggcaa ctcaattgct aagggttcca caaacaggat      2940
     aaagtttctt atatacaaaa aaaatgaagg tttcaaatta caccataaaa cccctcattg      3000
     cttatgtcta cttggcaggt aaaattccat ttcaaaagtt aaatgtactt aaaaaattac      3060
     ctaagactgg gtaaattaaa aaaattaaat gttgcaaaga aaaaattcaa aattcttatt      3120
     cttgaatgaa aaacgttctc ttactggtga ttgaggagga gaaacaaaga ctaacaaatg      3180
     aaaatgggag aatccacact cagagtgggg caattgaaca ggcaggggcg gatggatggc      3240
     agaggaggag gaatctggac tcaaggagct ggggggctct gggcctggaa tttcagggtc      3300
     tggggcccaa ggcaccagga gaagaggcag gtcaggatat ctgagtcaag acctgggatc      3360
     ttgccttagc aatgacactg gagactaaag gtggactcca tggtgccctt gagcccagcc      3420
     ctaccccatc tccactatcc tctgccacca gctgtgcaac ttctgctagg ggtgaggtta      3480
     ataaactgga gaagttaatt tgtggagcat gaaacagatg agcagaacaa tcacagcacc      3540
     ttaatttccc cagtgtgccc aagaacagag caggcctgaa gacactcaaa cagaaacaaa      3600
     catgtgccgt gtcactgata attctgtgta gacacacacc tgccagacac tgctcatggc      3660
     actccctagg aagaacagca tgtgggaaag gctgccaaaa ttgttcatgt aaaaattaca      3720
     tcaatgctgt cttcctcggt gctgcctatg cagctggcag ccatctcttc ctccacatca      3780
     tggcctccct cagactcctc atgaaggata agatcctcaa aaagaggacc aacaagttca      3840
     tgaggcacca atcagactga aatgtcaaaa ttaagcataa ctggcggaaa cccagaggtc      3900
     ttaacagtag ggttcgtaga aggtccaagg gccagatctt gatgcccaac attgcttatg      3960
     ggagcaacaa caacaacaaa aaacacatgc tgcccagtgg cttccagaag tttctggccc      4020
     acagcctcaa ggagctgaaa gtgctgctga tgtgcaacaa atcttactgt gctgagatcg      4080
     ctcacaaaat ttcctccaga actgcaaagt catcatggaa agagtcaccc agccggccat      4140
     cagagtcacc aaccccagta ccagggtgca cagctaagaa aatgagtaga aagttcatgt      4200
     ccacgttttg tgtgtaaata aaaccataaa aactgccaaa aaaaattaca tgaatgcctc      4260
     taaacccaaa ggactctacc cccacaggtc cctggttgtt gtggtgattt tcattgtgta      4320
     aaatactttc cacatctttt gacaccaagt ctttctgcag ccatgtttga aaattaactt      4380
     tcaggctaca gagtctttct tataccaaag ttgaagaaag ttttaagaaa tatatttcta      4440
     catctcctac atgcaaaaca acaggagcaa gttgaggaat tctcaagaaa ctggtcgaga      4500
     agagagagcg cttagctatg gaaaagagaa agaaggaagg gagggcttcc tggaggaggt      4560
     ggcatttgaa ccaggactga catcaggatg gaaatgtcag tcagggagtt aagtaggggg      4620
     agcagctccg ccctccacgt ccccagctcc tcccgcccct gttttttctc ccagtgaccc      4680
     cacgtgaaac gtctccgcct cctccagcca ccagcagaag ggactgcctt ccccttagtg      4740
     ctcgcccctc cctagtgatc actcagtgcc cctgagctca ttcttttcag taaattctct      4800
     ctctgcgtgg tgagaaaaca ggcctggaga ggctctgcga cccgcttagg accacagaac      4860
     tcggtactag gaaaactcct attttaaaat ccagccctga gtgggaagat ttgggaagaa      4920
     tcgttaatat tgagagagag agggagaaag aggattagat gagagtggcg cctccgctca      4980
     tgtccgcccc ctccccgcag agaattacgt gtaccagtta cggcaggaat gctacgcgtt      5040
     taatgggaca cagcgcttcc tggagagata catctacaac cggcaggagt acgcgcgctt      5100
     cgacagcgac gtgggagagt tccgggcggt gacggagctg gggcggcctg ctgcggagta      5160
     ctggaacagc cagaaggacc tcctggagga gaggcgggca gtgccggaca ggatgtgcag      5220
     acacaactac gagctggacg aggccgtgac cctgcagcgc cgaggtgagt gagggctttg      5280
     ggccggcggt cccagggcag ccccgcgggc ccgtgcccag ggcgcaggag cagccgggtt      5340
     ggcctaaggg accttagtgc cgggcggaaa ggggactttg ggttggggat tcatgggggg      5400
     agcccatctg gagcttgtca ggggagcgag cgcggggacc tggactgggc tgagcatgga      5460
     gtgaggagga cgggagcaga gagaccccgg ggacttcatc aggcctggca gctgactgca      5520
     tgtggggtga aaaaaaggaa gccacaggac agcgcacaag ggtatggtgt ggagatggag      5580
     gtggagatgg cacagcaggc cacacagaga agaaacctac agggagttag ctgggtttga      5640
     ggtgcttgag gggcagatgg gtggtctgat gggcaggtag acagaagggt ctgcagccgg      5700
     ggaggagact gagatacatg agaccatcca gggagagggg acccaggggg aagagcaaag      5760
     gactggatcc tgggaactgg acagttgtga tttggccaag acagaaaagc ctgtgaaaga      5820
     gaccaataaa acccaagtgc agtgtgagga gaggcccgca gagaagagtc ttggaagctg      5880
     aggggaggtg acctcagcag cacagtggac agcggtgcca gtgacttggg aaggtcagaa      5940
     aacagaagat ggaaagtggg tttggaaacc agggagacct ggggagagca ggttggccgc      6000
     agcggcagga gctggaatgg gagggggtgc atgaggctga gtgtggcgca tcctcctcgg      6060
     ggctgagatg gattttactt gtcttgggtt ccccacggct gtcacagggc agtgtctgag      6120
     ttcattcgtc tttttccttc aggaagtctg ggtgtaaagg gatggagaga ggtgaggtgt      6180
     gtgcagtaag aggatttctc aaggatggga caggaaggcc ttggagcttt ggcttcctcc      6240
     tgtgaacttg tggggtgggg agcctggtgc accaaccttt gggacttgag ggagtagtat      6300
     caggatgtgg gattgagccc tggacctttt ttctagaaag aggaaaaaaa tgaagggagg      6360
     aggaggagga agctggggag atcacacctt tgattttctt gttcctggaa agtgaaagga      6420
     agttcacctg ctatgagtga gaaggtggac acactgggtg gggatgaggt gagtgacatg      6480
     agcttaggaa agttgctgag gtaattggtt gagagaggtg ttcaaataaa agtaatgcaa      6540
     ttggcaaaaa ctgttactaa gactttgtag aggcacaaat cagtgacatg gcagcatctt      6600
     ctttcacagt aatcaactgc cagattgcag ggagccctga taccagccta aggagtgtga      6660
     gtttctcctc taggcccaca ggtccccaac ctcactcctc cgaagactct actggagatc      6720
     atctgtgatg cgcagatacc cagactcact gccccgagac tcagattccc tgggtgggga      6780
     ggtctgggga tctctgcttg taatcagctc cctagaggtt cccatgtagc cggataagta      6840
     ttgtcagaac actgaagatt tttgaaaaat gaaaaagaga aggttggaga tgtgtcttca      6900
     gaagactact aagggtgctg ggtagaggag ggaccagagg cagggagatg aggtaggaaa      6960
     ctgctattat ttgtcaggga aattgcaatc aagaaatgag ttagaacagg gaaaacacag      7020
     aggcagggga gaggtggaag ggggaggaaa ggagtagtga caattccagg gtgtatgctc      7080
     acccaaatct agaagtaatt gagcaaatgt tttctgggca ttagagaagg caactagaac      7140
     aaacaggaat ccttgccttg gtgaaatgta tttgaactgg gtcagaaatg aggccattgg      7200
     gtatcaagcc ttaactccag cgccccctgg aggtcgctga tgtggctcca ggctgacctg      7260
     ctcctgtcaa agaatattga gcaagatgcc tctcatggaa tgttctggga ccttaaaaca      7320
     gatacccaag tattccccct gatttcatgg ttcccagaag ctctatgggg aagaaattgt      7380
     acgtaattca caactgagat ttagacataa gttgaatagt gtaatggacg ttgagttaac      7440
     cgaggtaatg aagtagtgag acacaggtgc ccctgaaata aactcacatt gagggaagag      7500
     gctgacaatg tggatcagtc tgtaaacaag gcaaaaatac aatagggagt aagggttgtg      7560
     tgtcagttca agactgtact tttacctggc ccagcgccat gttggggtat ttgtgttctc      7620
     caggaagtag aaaggaaaga actgagtgat tagggaccta gaagactaat ttgagacatt      7680
     cctcttgatg aactgttctc tagggtagtc ctctgaaaga gctgttctct agtggatctc      7740
     cctgaatgaa ctgttctcta ggagcacttg acccttttct gtgtttgttt tttgttttgt      7800
     gtttgtgttt gtttttgaga caggttctcg ctctgtctcc caggctggag tgctgtggcg      7860
     ccatcatgac tcactgcagc ctcaacctcc tgggctcaag tgatcctcct gcctcagcct      7920
     cccatgtagc tagaactaca gatacatgta ccaccatgtc tggctaattt atttttcttt      7980
     ttagagatgg gttctcacta tgttgcccag gctggtctcg aaaccctggg ctcaagtgat      8040
     cctcacgcct cagcctccca aagtgctaag attataggca tgaccaccat gcctggcctt      8100
     ttctgccttc cgagaaggaa aaaggtactg gtggcagaga tccaaaagaa aagttgccag      8160
     tggcagtgtg gaaattgacc tgagaacaac agaacaagct ggggcacaaa tgcaaagatg      8220
     cagagggagg caacatctgg ttatctgtga gaccttcatg ggacctgaag acacatcctt      8280
     ttggaaaagg atgggatttc tactactcaa gcatgtaggg gctcaggata ttatgtaaat      8340
     atgaagattt tgagtttttg taagtgaggt aaaaaaaata cccaggttat ttacagaata      8400
     agacatgtca agctctcttc attttctttg tattttcatg aaataaaggt attagattaa      8460
     caggccacca taatgccatt gtctgtatat cttaatttca agatattatt tgagtaattt      8520
     ttgcatcctt tgtatcaaga tagaactttg aaaagacagg taatttcaca gttgattaaa      8580
     tattctttgc ccaaattact tttggttaaa atttctccta tatgtgctac agagtgcaaa      8640
     ctctgtctcc ctgccattcc gctatatact tactaattat tattttattc aagatcatgc      8700
     atgctctact tgaaggtcta tcttttcagt gctaccctta cccactagcc taatcacatt      8760
     atatctattt tcaacatcta ggaatcaatt acgtagtgaa catgcctaag aaataataat      8820
     ctgggcagat gcagtggctc aggcctgtaa tcccagcact ttgagaggct gagcgggtgg      8880
     atcacttgag gtcaggagtt ggtcaagtgc tcctagagaa ccagcctgac caacatggag      8940
     aaaccttgtc tctactgata atacaaaaat tagccaggtg aggtggcagg cacctataat      9000
     cccagctatt cgggaggctg aggaaggaga attgcttgaa cccctgaggt ggaggttgca      9060
     gtgagccaat attgcgccac tgcattccag acttggcaac agagcgacac tccacctcaa      9120
     caaaaagaaa gaaagagcga gattacgtct caaaaaagga aggaaggaag gacaatctca      9180
     aatgctattt cattattttc cttccccact cgtagtccag cctaaggtga acgtttcccc      9240
     ctccaagaag gggcccctgc agcaccacaa cctgcttgtc tgccacgtga cagatttcta      9300
     cccaggcagc attcaagtcc gatggttcct gaatggacag gaggaaacag ctggggtcgt      9360
     gtccaccaac ctgatccata atggagactg gaccttccag atcctggtga tgctggaaat      9420
     gaccccccag cagggagacg tctacatctg ccaagtggag cacaccagcc tggacagtcc      9480
     tgtcaccgtg gagtggagtg agtctctgat gaccgtctag accccacctc tgaagagcag      9540
     gggactctct ggctctgggg tccactcatc ttatcttctg catctatacc ctggggccat      9600
     gtccaaaccc catctttctt ctataccagc tcctgagcat agtttgaagc cagggcaatg      9660
     gagacttcct gaccttggct taggggttcc tgaagattca tagttctccc ccttgtcaga      9720
     gaatctaggg acactggctg atctcgaaac cctcacacac aggaactgac ctcacacata      9780
     ggaacagttc tcttctttca gcattttagc ctcttctcag gcattttgag aggcaacttc      9840
     tagaatcagc atttgccacc ttgttgaggt cacacccctg ttccggacat gagggtggct      9900
     ctttctgaat ttcctcttag caagcttttt cccctgcact gtcttcatcc cgatattctg      9960
     catcacgctc cagaatctca gacaggacat gagtagggat gcagctggtg gaggtgacac     10020
     taaacctggg tctgtccttc ccagaggcac agtctgattc tgcccggagt aagacattga     10080
     cgggagctgg gggcttcgtg ctggggctca tcatctgtgg agtgggcatc ttcatgcaca     10140
     ggaggagcaa gaaaggtgag aaagcctgca aggtgagcgg gacctacctt cccctggcat     10200
     attcacactt actccatgat gagggttcag acagaaaaga aatgtcagaa agctctagag     10260
     accactgaaa tcagatagtc ggggaacaaa catgacctat ggcgagaggg ggatcccagg     10320
     ctgggatctt aatgcagcca gatgcatgag gtcccaggtg ctcagactcc tgcggggcat     10380
     ccattgagtg gtggtcaatg gaatttggtg ggatggaaat gtttctctaa ctatctgagg     10440
     tggtttcaat ggctgaatac ataacctttc ctctttcatt tcagttcaac gaggatctgc     10500
     ataacaggta atattcctgc tttgatttcc ttggggggtg ggttacagga ggatatgact     10560
     cctttctgtg cattgtaata ctgaggctcc tccaggaagg gaatctcagg catgaacccc     10620
     tctttcaacc tcagctctcg ggtgagtagg gaaaaagcat tgcacggctc cattgctgaa     10680
     ggaagcagag atcagttctg ttctttatca gcctaagatg cagcctctca ccataatttt     10740
     tctctcctgg acttaaagga aggaggccag caacctggga taacttgtcc tttaccccca     10800
     cagggttcct gacctcaccg aaaagactaa tgtgccttag aacaagcatt tgctgtgttt     10860
     tgttagcacc tggttccagg acagaccctc agcttcccaa gaggatactg ctgccaagaa     10920
     cttgctctga agtcagtttc tatcgttctg ctctttgatt caaagcactg tttctctcac     10980
     tgggcctcca accatgttcc cttcttctta gcaccacaaa taatcaaaac ccaacataag     11040
     tgtttgtttt cctttaaaaa tatgcatcaa atcgtctctc attactttga gggttttagt     11100
     aaacagtagg agttaataaa gaagttcatt ttggtttaca cataggaaag aagagaagca     11160
     tgaaagtgga gatatgttaa ctattgtata atgtggcctg ttatacatga cactcttctg     11220
     aattgactgt atttcagtga gctgccccca aatcaagttt agtgccctca tccatttatg     11280
     tctcagaccg ctattcttaa ctattcaatg gtgagcagac tgcaaatctg cctgatagga     11340
     cccgtattcc cacagcacta attcaacata tatcttactg agagcatgtt ttatcattac     11400
     cattaagaag ttaaatgaac atcagaattt aaaatcataa atataatcta atacacttta     11460
     a                                                                     11461
//