Dbfetch

ID   LT882731; SV 1; linear; genomic DNA; STD; HUM; 11534 BP.
XX
AC   LT882731;
XX
DT   09-JUN-2017 (Rel. 133, Created)
DT   21-JUL-2017 (Rel. 133, Last updated, Version 2)
XX
DE   Homo sapiens, HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1707, allele HLA-DPB1*04:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11534
RA   Albrecht V.;
RT   ;
RL   Submitted (06-JUN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; 562411a6aff0e9886fca420ad8bf4ecc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11534
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1707"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=1
FT   CDS             join(367..466,4997..5260,9283..9564,10112..10222,
FT                   10552..10571)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I4EC15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:I4EC15"
FT                   /protein_id="SMY43987.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..4996
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=1
FT   exon            4997..5260
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=2
FT   intron          5261..9282
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=2
FT   exon            9283..9564
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=3
FT   intron          9565..10111
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=3
FT   exon            10112..10222
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=4
FT   intron          10223..10551
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=4
FT   exon            10552..11534
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=5
XX
SQ   Sequence 11534 BP; 3140 A; 2535 C; 2994 G; 2865 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgaact       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtgtctt tggggaaaat       720
     gggaccaaga ggtcctggat aaccttggac agacaaggtt tgcagagaga gaagttggca       780
     agtgcaggct cctgggcgtg ttcatgtctg catccagcct ggaggggact caggcagaga       840
     gccctaagct ggagtgtcca ggctctgagg atcactgagg attcagtgct cacgaagaat       900
     gcctcttatt ccccagggtg gagcaggagc ccacatccct tggacaatta aggagagaag       960
     ggagggaggg ggataggttt tagcccctga aggcattctc attaaaggta cttctcccag      1020
     cctccccaga acttggttag ggtactagag tgggttgcga cttgtaggaa gaatgagatg      1080
     aggttgtgtg ggtgcatgac agggattgag tgtaggttat cagacagcca aggaagcagt      1140
     aaccaagtga aaaatctctt cttcctgctg cctccctgtg gctggtgtaa tattatggca      1200
     tctatgatcc attgtttttc tctcaggata ctctcaggat atttcttttt atatatatat      1260
     atactttaag ttctagggta catgtgcaca acgtgcaggt ttgttacata tgtatacatg      1320
     tgccatgttg gtgtgctgca cctattaact cgtcatttac attaggtata tttcctaatg      1380
     ctatccctcc cccctccccc caccccacaa caggccccgg tgtatgatgt tccccttcct      1440
     gtgtccatgt gttctcattg ttcagttccc acctatgagt gagaacatgt ggtctttggt      1500
     tttttgtcct tgcaatagtt tgctgtgaat gatgatttcc agcttcctcc atgtccctac      1560
     aaaggacatg aactcatcct tttttatggc tgcacagtat tccatggtgt atatgtgtgc      1620
     attttcttaa tccagtctat cactgatgga cagttgggtt ggttccaagt ctttgctatt      1680
     gtgaatagtg ccgcaataaa catatgtgtg catgtgtctt tatagcagca tgatttataa      1740
     tcctttgggt atatatccag taatgggatg gctgggtcaa atggtatttc tagttctaga      1800
     tctttgagga attgccacac tgtcttgaga taccatctca caccagttaa aatggcgatc      1860
     attaaaaagt caggaaacaa caggtgctgg agaggatgtg gagaaatagg aacactttta      1920
     ctctgttggt gggactgtaa actagttcaa ccattgtact ctcaggacat ttctagtcca      1980
     aatttacacc aacactctga gaggaaggac tgcaaagtag gtaccttagt tttccactga      2040
     cttccacttt tcctgcttac acccttcctc ctagacctct ccacacccct cctaggacac      2100
     acctagaagg tactgacatc atgtcacctc ctcatctttc agggtagcaa ggttggaatc      2160
     tcctgaatac agcccctcaa gccctaaaac ctcttatcta ttaccttggg ttcattgtcc      2220
     aggaagggga ggagaacttg aacttgtagt cacagaaggg tgctgagaac taaccagcag      2280
     gacggctcag ccctgggaac tgcagagggg tgaggctggg gagagaggag gctggagcag      2340
     cactggtgac actgaacagt gtcaggagga agtgacggat gcagcgcccc catcccatag      2400
     gcagagctgt catgtgggat gagggacagt gttgggagcc accaaggaaa cccagaggtg      2460
     ggggagcaga gagcagaagg gggcatgtga tgctgggcag tgaaagggag gacgggcaaa      2520
     ggctgggttg aggtttgtag ggggaatgag atgaggcagt ggagccatgt gacagggact      2580
     gagggtagat tactggagct ccctgcgtag aatgaatgtt caatcaaaac ctgctggagg      2640
     gagagctgga gccatagggg agtgggtaaa gtgggcaggg ctgattccac aattccctgc      2700
     atgctccccc aactccacac acatccccaa cctcaaacag ggcacaagac caaagggctg      2760
     aggagccagg ctatagctta aagaggctgg gggagaaaag cttggctgag acaacccata      2820
     gggagctaga ggtttttaat atatcctatt ctgaataaga gacgaattca ttcagatcag      2880
     tggtttcaaa ccgtgctctg ggcaactcaa ttgctaaggg ttccacaaac aggataaagt      2940
     ttcttatata caaaaaaaaa tgaaggtttc aaattacacc ataaaacccc tcattgctta      3000
     tgtctacttg gcaggtaaaa ttccatttca aaagttaaat gtacttaaaa aattacctaa      3060
     gactgggtaa attaaaaaaa ttaaatgttg caaagaaaaa attcaaaatt cttattcttg      3120
     aatgaaaaac gttctcttac tggtgattga ggaggagaaa caaagactaa caaatgaaaa      3180
     tgggagaatc cacactcaga gtggggcaat tgaacaggca ggggcggatg gatggcagag      3240
     gaggaggaat ctggactcaa ggagctgggg ggctctgggc ctggaatttt agggtctggg      3300
     gcccaaggca ccaggagaag aggcaggtca ggatatctga gtcaagacct gggatcttgc      3360
     cttagcaatg acactggaga ctaaaggtgg actccatggt gcccttgagc ccagccctac      3420
     cccatctcca ctatcctctg ccaccagctg tgcaacttct gctaggggtg aggttaataa      3480
     actggagaag ttaatttgtg gagcatgaaa cagatgagca gaacaatcac agcaccttaa      3540
     tttccccagt gtgcccaaga acagagcagg cctgaagata ctcaaacaga aacaaacatg      3600
     tgccgtgtca ctgataattc tgtgtagaca cacacctgcc agacactgct catggcactc      3660
     cctaggaaga acagcatgtg ggaaaggctg ccaaaattgt tcatgtaaaa attacatcaa      3720
     tgctgtcttc ctcggtgctg cctatgcagc tggcagccat ctcttcctcc acatcatggc      3780
     ctccctcaga ctcctcatga aggataagat cctcaaaaag aggaccaaca agttcatgag      3840
     gcaccaatca gactgaaatg tcaaaattaa gcataactgg cggaaaccca gaggtcttaa      3900
     cagtagggtt cgtagaaggt ccaagggcca gatcttgatg cccaacattg cttatgggag      3960
     caacaacaac aacaaaaaaa acatgctgcc cagtggcttc cagaagtttc tggtccacag      4020
     cctcaaggag ctgaaagtgc tgctgatgtg caacaaatct tactgtgctg agatcgctca      4080
     caaaatttcc tccagaactg caaagtcatc atggaaagag tcacccagcc ggccatcaga      4140
     gtcaccaacc ccagtaccag ggtgcacagc taagaaaatg agtagaaagt tcatgtccac      4200
     gttttgtgtg taaataaaac cataaaaact gccaaaaaaa attacatcaa tgcctctaaa      4260
     cccaaaggac tctaccccca caggtccctg gttgttgtgg tgattttcat tgtgtaaaat      4320
     actttccaca tcttttgaca ccaagtcttt ctgcagccat gtttgaaaat taactttcag      4380
     gctacagagt ctttcttata ccaaagttga agaaagtttt aagaaatata tttctacatc      4440
     tcctacatgc aaaacaacag gagcaagttg aggaattctc aagaaactgg tcgagaagag      4500
     agagcgctta gctatggaaa agagaaagaa ggaagggagg gcttcctgga ggaggtggca      4560
     tttgaaccag gactgacatc aggatggaaa tgtcagtcag ggagttaagt agggggagca      4620
     gctccgccct ccacgtcccc agctcctccc gcccctgttt tttctctcag tgaccccacg      4680
     tgaaacgtct ccgcctcctc cagccaccag cagaagggac tgccttcccc tcagtgctcg      4740
     cccctcccta gtgatcactc agtgcccctg agctcattct tttcagtaaa ttctctctct      4800
     gcgtggtgag aaaacaggcc tggagaggct ctgcgacccg cttaggacca cagaactcgg      4860
     tactaggaaa actcctattt taaaatccag ccctgggtgg gaagatttgg gaagaatcgt      4920
     taatattgag agagagaggg agaaagagga ttagatgaga gtggcgcctc cgctcatgtc      4980
     cgccccctcc ccgcagagaa ttaccttttc cagggacggc aggaatgcta cgcgtttaat      5040
     gggacacagc gcttcctgga gagatacatc tacaaccggg aggagttcgc gcgcttcgac      5100
     agcgacgttg gggagttccg ggcggtgacg gagctggggc ggcctgctgc ggagtactgg      5160
     aacagccaga aggacatcct ggaggagaag cgggcagtgc cggacaggat gtgcagacac      5220
     aactacgagc tgggcgggcc catgaccctg cagcgccgag gtgagtgagg gctttgggcc      5280
     ggcggtccca gggcagcccc gcgggcccgt gcccagggcg caggagcagc cgggttggcc      5340
     taagggacct tagtgccggg cggaaagggg actttgggtt ggggattcat ggggggagcc      5400
     catctggagc ttgtcagggg agcgagcgcg gggacctgga ctgggctgag catggagtga      5460
     ggaggacgag agcagagaga cccccgggac ttcatcaggc ctggcagctg actgcatgtg      5520
     gggtgaaaaa aggaagccac aggacagcgc acaagggtat ggtgtggaga tggaggtgga      5580
     gatggcacag caggccacac agagaagaaa cctacaggga ggtagctggg tttgaggtgc      5640
     ttgaggggca gatgggtggt ctgatgggca ggtagacaga agggtctgca gccggggagg      5700
     agactgagat acatgagacc atccagggag aggggaccca gggggaagag caaaggaccg      5760
     gatcctggga actggacagt tgtgatttgg ccaagacaga aaagcctgtg aaagagacca      5820
     aaaaaaccca agtgcagtgt gaggagaggc ccgcagagaa gagtcttgga agctgagggg      5880
     aggtgacctc agcagcacag tggacagcgg tgccagtgac ttgggaaggt cagaaaacag      5940
     aagatggaaa gtgggtttgg aaaccaggga gacctgggga gagcaggttg gccgcagcgg      6000
     caggagctgg aatgggaggg ggtgcatgag gctgagtgtg gcgcatcctc ctcggggctg      6060
     agatggattt tacttgtctt gggttcccca cggctgtcac agggcagtgt ctcagttcat      6120
     tcgtcttttt ccttcaggaa gtctgggtgt aaagggatgg agagaggtga ggtgtgtgca      6180
     gtaagaggat ttctcaagga tgggacagga aggccttgga gctttggctt cctcctgtga      6240
     acttgtgggg tggggagcct ggtgcaccaa cctgagggac ttgagggagt agtatcagga      6300
     tgtgggattg agccctggac cttttttcta gaaagaggaa aaaaatgaag ggaggaggag      6360
     gaggaagctg gggagatcac acctttgatt ttcttgttcc tggaaagtga aaggaagttc      6420
     acctgctatg agtgagaagg tggacacact gggtggggat gaggtgagtg acatgagctt      6480
     aggaaagttg ctgaggtaat tggttgagag aggtgttcaa ataaaaataa cgcaattggc      6540
     aaaaactgtt actaagactt tgtagaggca ccaatcagtg acatggcagc attttctttc      6600
     acagtaatca actgccagat tgcagacagc cctgatgcca gcctaaggag tgtgggtttc      6660
     tcctccaggc ccgcaggtcc ccaacctcac tcctctgaag actcttctgg agatcctctg      6720
     tgatgcacag atctccagac tcagtgcccc cagactcaga ttccctgggt ggggaggtct      6780
     ggggatctct gcttgtaatc agctccctag aggttcccat gtagccagat aagtattgtc      6840
     agaacactga agatttttga aaaatgaaaa agagaaggtt ggagatgtgt cttcagaaga      6900
     ctactaaggg tgctggctag aggagggacc agaggcaggg agatgaggta ggaaactgct      6960
     attatttgtc agggaaattg caatcaaggc atgagttaga acagggaaaa cacagaggca      7020
     agggagaggt ggaaggggga ggaaagaagt agtgacaatt ccagggtgga tgtccaccca      7080
     aatctagaag taattgagca aatgttttct gggcattaga gaaggcaact agaacaaaca      7140
     ggaatccttg ccttggtgaa atgtatttga actgggtcag aaatgaggcc attgggtatc      7200
     aggccttaac tccagcgcac cctggaggtc actgatgtgg ctccaggctg acctgctcct      7260
     gtcaaagaat attgagcaag atgcctctcg tggaatgttc tgggacctta aaacagatac      7320
     ccaagtattc cccctgattt catggttccc agaagctcta tggggaagaa attgtaggta      7380
     attcacaact gagatttaga cataagttga atagtgtaat ggacattgag ttaaccgagg      7440
     taatgaagta gtgagacaca ggtgcccctg aaataaactc acattgaggg aagaggctga      7500
     caatgtggat cagtctgaaa acaaggcaaa aatacaatag ggagtaaggg ttgtgtgtca      7560
     gttcaagact gtacttttac ctggcccagc gccatgttag ggtatttgtg ttctccagga      7620
     agtagaaagg aaagaactga gtgattaggg acctagaaga ctaatttgag acattcctct      7680
     tgatgagctg ttctctaggg tagtcctctg aaagagctgt tctctagtgg atctccctga      7740
     atgaactgtt ctctaggagc acttgaccct tttctgtgtt tgttttttgt tttgtgtttg      7800
     tgtttgtttt tgagacaggt tctcactttg tctcccaggc tggagtgctg tggcaccatc      7860
     atggctcact gcagcctcaa cctcctgggc tcaagtgatc ctcctgcctc agcctcccat      7920
     gtagctagaa ctacagatac acgtaccacc atgtctggct aatttatttt tctttttaga      7980
     gatgggttct cactatgttg cccaggccgg tctcaaaacc ctgggctcaa gtgatcctca      8040
     tgcctcaacc tcccaaagtg ctaagattat aggcatgacc accatgcctg gccttttctg      8100
     ctttctgagg aggaaaaagg tactggtggc agagatccaa aagaaaagtt gccagtggca      8160
     gtgtggaaat tcacctgaga acaacaggac aagctggggc acaaatgcaa agatgcagag      8220
     ggaggcaaca cctggtcatc tgtgagacct tcatgggacc tgaagacgca gcacagagga      8280
     ggaacttgaa aaaggacggg atttctacta ctcaagcatg taggagctca ggatattctg      8340
     taaatatgaa gattttgagt ttttgtaggt gaggtaaaaa aatacatagg ttttttacag      8400
     aataagacat gtaaagctct cttcattttc tttgtatttt catgaagtta ttagattcac      8460
     aggccaccat aatgccattg tctgtatatc ttaatttcaa gatattattt gagtaaattt      8520
     tgcttccttt gtatcaagat agaactttga aaaggtaggt aatttcacag ttgatcaaat      8580
     attctttgcc caaattactt ttggttaaaa tttctcctaa atgtgctaca gagtgcaaac      8640
     tctgtctccc tgccattccg ctatatactt actaactatt attttattca agatcatgca      8700
     tgctctactt gaaggtctat ttctatcttt tcaatgctac ccttacccac tagcctaatc      8760
     acattattcc tattttcaac atctaggaat caattacata gtgaacatgc ctaagaaata      8820
     ataatctggg cagatgcagt ggctcaggcc cgtaatccca gccctttgag aggccgagcg      8880
     ggtggatcac ttgaggtcag gcgttggtca agtgctccta gagaaccagg ctgaccaaca      8940
     tggagaaacc ttgtctctac taataataca aaaattagcc aggtgaagtg gcaggcacct      9000
     ataatcccag ctattcggga ggctgaggaa ggagaattgg ttgaagcccg gaggtggagg      9060
     ttgcagtgag ccaatattgc gccactgcat tccagacttg gcaacagagt gacactccat      9120
     ctcaacaaaa agaaagaatg aaagaaagaa agagcgagat tatgtctcaa aaaaaaggaa      9180
     ggaaggaagg aaggaaggaa ggaaggaagg aaggaaggaa ggaaggaagg aaagaaggac      9240
     aatctcaaat tctatttcat tatttttctt ccacgctcct agtccagcct agggtgaatg      9300
     tttccccctc caagaagggg cccttgcagc accacaacct gcttgtctgc cacgtgacgg      9360
     atttctaccc aggcagcatt caagtccgat ggttcctgaa tggacaggag gaaacagctg      9420
     gggtcgtgtc caccaacctg atccgtaatg gagactggac cttccagatc ctggtgatgc      9480
     tggaaatgac cccccagcag ggagatgtct acacctgcca agtggagcac accagcctgg      9540
     atagtcctgt caccgtggag tggagtgagt ctctgatgac cctctagacc ccacctctga      9600
     agagcagggg actctctggc tctggggtcc actcatctta tcttctgcat ctataccctg      9660
     gggccatgtc caaaccccat ctttcttcta taccagctcc tgagcatagt ttgaagccag      9720
     ggaaatggag acttcctgac cttggcttag gggttcctga agattcatag ttctccccct      9780
     tgtcagagaa tctagggaca ctgactggtc tcgaaaccct cacacttagg aactgacctc      9840
     acacatagga acagttctct tccttcagca ttttagcctc ttctcaggca ttttgagagg      9900
     caacttccag aatcagcatt tgccaccttg ttgaggtcac acccctgttc cagatatgag      9960
     ggtggctctt tctgaatttc ctcttagcaa gctttttccg ctgcactgtc ctcatcccga     10020
     tatgctgcat caggctccag aatctcagac aggacatgag tagggatgca gctggtggag     10080
     gtgacactaa acctgggtct gtccttccca gaggcacagt ctgattctgc ccggagtaag     10140
     acattgacgg gagctggggg cttcgtgctg gggctcatca tctgtggagt gggcatcttc     10200
     atgcacagga ggagcaagaa aggtgagaaa gcctgcaggg tgagcgggac ttaccttccc     10260
     ctggcatatt cacacttatt ccacgatgag gggtttgaca gaaaagaaat gtcagaaagc     10320
     tctagaggcc actgatatca gataatcggg gaacaaacat gacctatagc gagagaggga     10380
     tcccaggctg ggatcttaat gcagccagat gcatgaggtc ccaagtactc aggctcctgc     10440
     ggagcgtcca ttgagtgatg ggcaatggaa tttggtggga tggaaatgtt tctctaatta     10500
     tctgaggtgg tttcaatggc tgattatata acctttcgtc tttcatttca gttcaacgag     10560
     gatctgcata aacaggtaat attcctgctt tgatttcctt gtggggtggg ttgcaggagg     10620
     atatgagtcc tttctgtgca ttgtaacact gaggctcctc caggaaggga atctcaggca     10680
     tgaacccctc tttcaatgtc agccttcagg caagtgggga aagagcattg cttggctcca     10740
     ttgctgaagg aagcagagat caactctgtt atttatcagc ctgagacgca tcctctcacc     10800
     ataatttttc tctcctggac ttacaggaag gaggctggca acctgggata acttgtcttt     10860
     tacccccaca gggttcctga gctcactgaa aagactattg tgccttagga aaagcatttg     10920
     ctgtgtttcg ttagcatctg gctccaggac agaccttcaa cttccaaatt ggatactgct     10980
     gccaagaagt tgctctgaag tcagtttcta tcattctgct ctttgattca aagcactgtt     11040
     tctctcactg ggcctccaac catgttccct tcttcttagc accacaaata atcaaaaccc     11100
     aacatgactg tttgttttcc tttaaaaata tgcaccaaat catctctcat cacttttctc     11160
     tgagggtttt agtagacagt aggagttaat aaagaagttc attttggttt aaacatagga     11220
     aagaagagaa ccatgaaaat ggggatatgt taactattgt ataatggggc ctgttacaca     11280
     tgacactctt ctgaattgac tgtatttcag tgagctgccc ccaaatcaag tttagtgccc     11340
     tcatccattt atgtctcaga ccactattct taactattca atggtgagca gactgcaaat     11400
     ctgcctgata ggacccatat tcccacagca ctaattcaac atatacctta ctgagagcat     11460
     gttttatcat taccattaag aagttaaatg aacatcagaa tttaaaatca taaatataat     11520
     ctaatacact ttaa                                                       11534
//