Dbfetch

ID   LT719010; SV 1; linear; genomic DNA; STD; HUM; 11468 BP.
XX
AC   LT719010;
XX
DT   28-JAN-2017 (Rel. 131, Created)
DT   28-JAN-2017 (Rel. 131, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1678, allele HLA-DPB1*463:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11468
RA   Albrecht V.;
RT   ;
RL   Submitted (25-JAN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RA   Lang K., Schoefl G., Schmidt A., Lange V.;
RT   "Complementing the HLA-DPB1 Database: Full-Length Gene Characterization of
RT   all Common and Well-Documented Alleles";
RL   Unpublished.
XX
DR   MD5; fb6e7c95f4f829f57062a324e8d289f3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11468
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1678"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=1
FT   CDS             join(367..466,5003..5266,9217..9498,10046..10156,
FT                   10486..10505)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1N7SYI1"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1N7SYI1"
FT                   /protein_id="SJK83325.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDR
FT                   MCRHNYELGGPMTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFMLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5002
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=1
FT   exon            5003..5266
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=2
FT   intron          5267..9216
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=2
FT   exon            9217..9498
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=3
FT   intron          9499..10045
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=3
FT   exon            10046..10156
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=4
FT   intron          10157..10485
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=4
FT   exon            10486..11468
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*463:new"
FT                   /number=5
XX
SQ   Sequence 11468 BP; 3108 A; 2535 C; 2965 G; 2860 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcgcc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgaact       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     gaaaatggga ccaagaggtc ctggataacc ttggacagac aaggtttgca gagagagaag       780
     ttggcaagtg caggctcctg ggcgtgttca tgtctgcatc cagcctggag gggactcagg       840
     cagagagccc taagctggag tgtccaggct ctgaggatca ctgaggattc agtgctcacg       900
     aagaatgcct cttattcccc agggtggagc aggagcccac atcccttgga caattaagga       960
     gagaagggag ggagggggat aggttttagc ccctgaaggc attctcatta aaggtacttc      1020
     tcccagcctc cccagaactt ggttagggta ctagagtggg ttgcgacttg taggaagaat      1080
     gagatgaggt tgtgtgggtg catgacaggg attgagtgta ggttatcaga cagccaagga      1140
     agcagtaacc aagtgaaaaa tctcttcttc ctgctgcctc cctgtggctg gtgtaatatt      1200
     atggcatcta tgatccattg tttttctctc aggatactct caggatattt ctttttatat      1260
     atatatatac tttaagttct agggtacatg tgcacaacgt gcaggtttgt tacatatgta      1320
     tacatgtgcc atgttggtgt gctgcaccca ttaactcgtc atttacatta ggtatatttc      1380
     ctaatgctat ccctcccccc tccccccacc ccacaacagg ccccggtgta tgatgttccc      1440
     cttcctgtgt ccatgtgttc tcattgttca gttcccacct atgagtgaga acatgtggtc      1500
     tttggttttt tgtccttgca atagtttgct gtgaatgatg gtttccagct tcctccatgt      1560
     ccctacaaag gacatgaact catccttttt tatggctgca cagtattcca tggtgtatat      1620
     gtgtgcattt tcttaatcca gtctatcact gatggacagt tgggttggtt ccaagtcttt      1680
     gctattgtga atagtgccgc tataaacata tgtgtgcatg tgtctttata gcagcatgat      1740
     ttataatcct ttgggtatat acccagtaat gggatggctg ggtcaaatgg tatttctagt      1800
     tctagatcct tgaggaattg ccacactgtc ttgagatacc atctcacacc agttaaaatg      1860
     gcgatcatta aaaagtcagg aaacaacagg tgctggagag gatgtggaga aataggaaca      1920
     cttttactct gttggtggga ctgtaaacta gttcaaccat tgtactctca ggacatttct      1980
     agtccaaatt tacaccaaca ctctgagagg aaggactgca aagtaggtac cttagttttc      2040
     cactgacttc cacttttcct gcttacaccc ttcctcctag acctctccac acccctccta      2100
     ggacacacct aaaaggtact gacatcatgt cacctcctca tctttcaggg tagcaaggtt      2160
     ggaatctcct gaatacagcc cctcaagccc taaaacctct tatctattac cttgggttca      2220
     ttgtccagga aggggaggag aacttgaact tgtagtcaca gaagggtgct gagaactaac      2280
     cagcaggacg gctcagccct gggaactgca gaggggtgag gctggggaga gaggaggctg      2340
     gagcagcact ggtgacactg aacagtgtca ggaggaagtg acggatgcag cgcccccatc      2400
     ccataggcag agctgtcatg tgggatgagg gacagtgttg ggagccacca aggaaaccca      2460
     gaggtggggg agcagagagc agaagggagc atgtgatgct ggacagtgaa agggaggaca      2520
     ggcaaaggct gggttgaggt ttgtaggggg aatgagatga ggcagtggag ccatgtgaca      2580
     gggactgagg gtagattact ggagctccct gcgtagaatg aatgttcaat caaaatttgc      2640
     tggagggaga gctggagcca taggggagtg ggtaaagtgg gcagggctga ttccacaatt      2700
     ccctgcatgc tcccccaact ccacacacat ccccaacctc aaacagggca caagaccaaa      2760
     gggctgagga gccaggctat agcttaaaga ggctggggga gaaaagcttg gctgagacaa      2820
     cccataggga gctagaggtt tttaatatat cctattctga ataagagacg aattcattca      2880
     gatcagtggt ttcaaaccgt gctctgggca actcaattgc taagggttcc acaaacagga      2940
     taaagtttct tatatacaaa aaaaaatgaa ggtttcaaat tacaccataa aacccctcat      3000
     tgcttatgtc tacttggcag gtaaaattcc atttcaaaag ttaaatgtac ttaaaaaatt      3060
     acctaagact gggtaaatta aaaaaattaa atgttgcaaa gaaaaaattc aaaattctta      3120
     ttcttgaatg aaaaacgttc tcttactggt gattgaggag gagaaacaaa gactaacaaa      3180
     tgaaaatggg agaatccaca ctcagagtgg ggcaactgaa caggcagggg cggatggatg      3240
     gcagaggagg aggaatctgg actcaaggag ctggggggct ctgggcctgg aattttaggg      3300
     tctggggccc aaggcaccag gagaagaggc aggtcaggat atctgagtca agacctggga      3360
     tcttgcctta gcaatgacac tggagactaa aggtggactc catggtgccc ttgagcccag      3420
     ccctacccca tctccactat cctctgccac cagctgtgca acttctgcta ggggtgaggt      3480
     taataaactg gagaagttaa tttgtggagc atgaaacaga tgagcagaac aatcacagca      3540
     ccttaatttc cccagtgtgc ccaagaacag agcaggcctg aagatactca aacagaaaca      3600
     aacatgtgcc gtgtcactga taattctgtg tagacacaca cctgccagac actgctcatg      3660
     gcactcccta ggaagaacag catgtgggaa aggctgccaa aattgttcat gtaaaaatta      3720
     catcaatgct gtcttcctcg gtgctgccta tgcagctggc agccatctct tcctccacat      3780
     catggcctcc ctcagactcc tcatgaagga taagatcctc aaaaagagga ccaacaagtt      3840
     catgaggcac caatcagact gaaatgtcaa aattaagcat aactggcgga aacccagagg      3900
     tcttaacagt agggttcgta gaaggtccaa gggccagatc ttgatgccca acattgctta      3960
     tgggagcaac aacaacaaca aaaaaaacat gctgcccagt ggcttccaga agtttctggt      4020
     ccacagcctc aaggagctga aagtgctgct gatgtgcaac aaatcttact gtgctgagat      4080
     cgctcacaaa atttcctcca gaactgcaaa gtcatcatgg aaagagtcac ccagccggcc      4140
     atcagagtca ccaaccccag taccagggtg cacagctaag aaaatgagta gaaagttcat      4200
     gtccacgttt tgtgtgtaaa taaaaccata aaaactgcca aaaaaaatta catcaatgcc      4260
     tctaaaccca aaggactcta cccccacagg tccctggttg ttgtggtgat tttcattgtg      4320
     taaaatactt tccacatctt ttgacaccaa gtctttctgc agccatgttt gaaaattaac      4380
     tttcaggcta cagagtcttt cttataccaa agttgaagaa agttttaaga aatatatttc      4440
     tacatctcct acatgcaaaa caacaggagc aagttgagga attctcaaga aactggtcga      4500
     gaagagagag cgcttagcta tggaaaagag aaagaaggaa gggagggctt cctggaggag      4560
     gtggcatttg aaccaggact gacatcagga tggaaatgtc agtcagggag ttaagtaggg      4620
     ggagcagctc cgccctccac gtccccagct cctcccgccc ctgttttttc tcccagtgac      4680
     cccacgtgaa acgtctccgc ctcctccagc caccagcaga agggactgcc ttcccctcag      4740
     tgctcgcccc tccctagtga tcactcagtg cccctgagct cattcttttc agtaaattct      4800
     ctctctgcgt ggtgagaaaa caggcctgga gaggctctgc gacccgctta ggaccacaga      4860
     actcggtact aggaaaactc ctattttaaa atccagccct gggtgggaag atttgggaag      4920
     aatcgttaat attgagagag agagggagaa agaggattag atgagagtgg cgcctccgct      4980
     catgtccgcc ccctccccgc agagaattac cttttccagg gacggcagga atgctacgcg      5040
     tttaatggga cacagcgctt cctggagaga tacatctaca accgggagga gttcgtgcgc      5100
     ttcgacagcg acgtggggga gttccgggcg gtgacggagc tggggcggcc tgatgaggag      5160
     tactggaaca gccagaagga catcctggag gaggagcggg cagtgccgga caggatgtgc      5220
     agacacaact acgagctggg cgggcccatg accctgcagc gccgaggtga gtgagggctt      5280
     tgggccggcg gtcccagggc agccccgcgg gcccgtgccc agggcgcagg agcagccggg      5340
     ttggcctaag ggaccttagt gccgggcgga aaggggactt tgggttgggg attcatgggg      5400
     ggagcccatc tggagcttgt caggggagcg agcgcgggga cctggactgg gctgagcatg      5460
     gagtgaggag gacgagagca gagagacccc cgggacttca tcaggcctgg cagctgactg      5520
     catgtggggt gaaaaaagga agccacagga cagcgcacaa gggtatggtg tggagatgga      5580
     ggtggagatg gcacagcagg ccacacagag aagaaaccta cagggaggta gctgggtttg      5640
     aggtgcttga ggggcagatg ggtggtctga tgggcaggta gacagaaggg tctgcagccg      5700
     gggaggagac tgagatacat gagaccatcc agggagaggg gacccagggg gaagagcaaa      5760
     ggaccggatc ctgggaactg gacagttgtg atttggccaa gacagaaaag cctgtgaaag      5820
     agaccaaaaa aacccaagtg cagtgtgagg agaggcccgc agagaagagt cttggaagct      5880
     gaggggaggt gacctcagca gcacagtgga cagcggtgcc agtgacttgg gaaggtcaga      5940
     aaacagaaga tggaaagtgg gtttggaaac cagggagacc tggggagagc aggttggccg      6000
     cagcggcagg agctggaatg ggagggggtg catgaggctg agtgtggcgc atcctcctcg      6060
     gggctgagat ggattttact tgtcttgggt tccccacggc tgtcacaggg cagtgtctca      6120
     gttcattcgt ctttttcctt caggaagtct gggtgtaaag ggatggagag aggtgaggtg      6180
     tgtgcagtaa gaggatttct caaggatggg acaggaaggc cttggagctt tggcttcctc      6240
     ctgtgaactt gtggggtggg gagcctggtg caccaacctg agggacttga gggagtagta      6300
     tcaggatgtg ggattgagcc ctggaccttt tttctagaaa gaggaaaaaa atgaagggag      6360
     gaggaggagg aagctgggga gatcacacct ttgattttct tgttcctgga aagtgaaagg      6420
     aagttcacct gctatgagtg agaaggtgga cacactgggt ggggatgagg tgagtgacat      6480
     gagcttagga aagttgctga ggtaattggt tgagagaggt gttcaaataa aagtaatgca      6540
     attggcaaaa actgttacta agactttgta gaggcacaaa tcagtgacat ggcagcatct      6600
     tctttcacag taatcaactg ccagattgca gggagccctg ataccagcct aaggagtgtg      6660
     agtttctcct ctaggcccac aggtccccaa cctcactcct ccgaagactc tcctggagat      6720
     catctgtgat gcgcagatac ccagactcac tgccccgaga ctcagattcc ctgggtaggg      6780
     aggtcggggg atctctgctt gtaatcagct ccctagaggt tcccatgtag ccggataagt      6840
     attgtcagaa cactgaagat ttttgaaaaa tgaaaaagag aaggttggag atgtgtcttc      6900
     agaagactac taagggtgct aggtagagga gggaccagag gcagggagat gaggtaggaa      6960
     actgctatta tttgtcaggg aaattgcaat caagaaatga gttagaacag ggaaaacaca      7020
     gaggcagggg agaggtggaa gggggaggaa aggagtagtg acaattccag ggtgtatgct      7080
     cacccaaatc tagaagtaat tgagcaaatg ttttctgggc attagagaag gcaactagaa      7140
     caaacaggaa tccttgcctt ggtgaaatgt atttgaactg ggtcagaaat gaggccattg      7200
     ggtatcaagc cttaactcca gcgccccctg gaggtcgctg atgtggctcc aggctgacct      7260
     gctcctgtca aagaatattg agcaagatgc ctctcatgga atgttctggg accttaaaac      7320
     agatacccaa gtattccccc tgatttcatg gttcccagaa gctctatggg gaagaaattg      7380
     tacgtaattc acaactgaga tttagacata agttgaatag tgtaatggac gttgagttaa      7440
     ccgaggtaat gaagtagtga gacacaggtg cccctgaaat aaactcacat tgagggaaga      7500
     ggctgacaat gtggatcagt ctgtaaacaa ggcaaaaata caatagggag taagggttgt      7560
     gtgtcagttc aagactgtac ttttacctgg cccagcgcca tgttggggta tttgtgttct      7620
     ccaggaagta gaaaggaaag aactgagtga ttagggacct agaagactaa tttgagacat      7680
     tcctcttgat gaactgttct ctagggtagt cctctgaaag agctgttctc tagtggatct      7740
     ccctgaatga actgttctct aggagcactt gacccttttc tgtgtttgtt ttttgttttg      7800
     tgtttgtgtt tgtttttgag acaggttctc gctctgtctc ccaggctgga gtgctgtggc      7860
     gccatcatga ctcactgcag cctcaacctc ctgggctcaa gtgatcctcc tgcctcagcc      7920
     tcccatgtag ctagaactac agatacatgt accaccatgt ctggctaatt tatttttctt      7980
     tttagagatg ggttctcact atgttgccca ggctggtctc gaaaccctgg gctcaagtga      8040
     tcctcacgcc tcagcctccc aaagtgctaa gattataggc atgaccacca tgcctggcct      8100
     tttctgcctt ccgagaagga aaaaggtact ggtggcagag atccaaaaga aaagttgcca      8160
     gtggcagtgt ggaaattgac ctgagaacaa cagaacaagc tggggcacaa atgcaaagat      8220
     gcagagggag gcaacatctg gttatctgtg agaccttcat gggacctgaa gacacatcct      8280
     tttggaaaag gatgggattt ctactactca agcatgtagg ggctcaggat attatgtaaa      8340
     tatgaagatt ttgagttttt gtaagtgagg taaaaaaaat acctaggtta tttacagaat      8400
     aagacatgtc aagctctctt cattttcttt gtattttcat gaaataaagg tattagatta      8460
     acaggccacc ataatgccat tgtctgtata tcttaatttc aagatattat ttgagtaatt      8520
     tttgcatcct ttgtatcaag atagaacttt gaaaagacag gtaatttcac agttgattaa      8580
     atattctttg cccaaattac ttttggttaa aatttctcct atatgtgcta cagagtgcaa      8640
     actctgtctc cctgccattc cgctatatac ttactaatta ttattttatt caagatcatg      8700
     catgctctac ttgaaggtct atcttttcag tgctaccctt acccactagc ctaatcacat      8760
     tatatctatt ttcaacatct aggaatcaat tacgtagtga acatgcctaa gaaataataa      8820
     tctgggcaga tgcagtggct caggcctgta atcccagcac tttgagaggc tgagcgggtg      8880
     gatcacttga ggtcaggagt tggtcaagtg ctcctagaga accagcctga ccaacatgga      8940
     gaaaccttgt ctctactgat aatacaaaaa ttagccaggt gaggtggcag gcacctataa      9000
     tcccagctat tcgggaggct gaggaaggag aattgcttga acccctgagg tggaggttgc      9060
     agtgagccaa tattgcgcca ctgcattcca gacttggcaa cagagcgaca ctccacctca      9120
     acaaaaagaa agaaagagcg agattacgtc tcaaaaaagg aaggaaggaa ggacaatctc      9180
     aaatgctatt tcattatttt ccttccccac tcgtagtcca gcctaaggtg aacgtttccc      9240
     cctccaagaa ggggcccctg cagcaccaca acctgcttgt ctgccacgtg acagatttct      9300
     acccaggcag cattcaagtc cgatggttcc tgaatggaca ggaggaaaca gctggggtcg      9360
     tgtccaccaa cctgatccgt aatggagact ggaccttcca gatcctggtg atgctggaaa      9420
     tgacccccca gcagggagac gtctacatct gccaagtgga gcacaccagc ctggacagtc      9480
     ctgtcaccgt ggagtggagt gagtctctga tgaccgtcta gaccccacct ctgaagagca      9540
     ggggactctc tggctctggg gtccactcat cttatcttct gtatctatac cctggggcca      9600
     tgtccaaacc tcatctttct tctataccag ctcctgagca tagtttgaag ccagggcaat      9660
     ggagacttcc tgaccttggc ttaggggttc ctgaagattc atagttctcc cccttgtcag      9720
     agaatctagg gacactggct gatctcgaaa ccctcacaca caggaactga cctcacacat      9780
     aggaacagtt ctcttctttc agcattttag cctcttctca ggcattttga gaggcaactt      9840
     ctagaatcag catttgccac cttgttgagg tcacacccct gttccggaca tgagggtggc      9900
     tctttctgaa tttcctctta gcaagctttt tcccctgcac tgtcttcatc ccgatattct      9960
     gcatcacgct ccagaatctc agacaggaca tgagtaggga tgcagctggt ggaggtgaca     10020
     ctaaacctgg gtctgtcctt cccagaggca cagtctgatt ctgcccggag taagacattg     10080
     acgggagctg ggggcttcat gctggggctc atcatctgtg gagtgggcat cttcatgcac     10140
     aggaggagca agaaaggtga gaaagcctgc aaggtgagcg ggacttacct tcccctggca     10200
     tattcacact tactccatga tgagggttca gacagaaaag aaatgtcaga aagctctaga     10260
     gaccactgaa atcagatagt tggggaacaa acatgaccta tggcgagagg gggatcccag     10320
     gctgggatct taattcagcc agatgcatga ggtcccaggt gctcagactc ctgcggggca     10380
     tccattgagt ggtggtcaat ggaatttggt gggatggaaa tgtttctcta actatctgag     10440
     gtggtttcaa tggctgaata cataaccttt cctctttcat ttcagttcaa cgaggatctg     10500
     cataaacagg taatattcct gctttgattt ccttgggggg tgggttacag gaggatatga     10560
     ctcttttctg tgcattgtaa tactgaggct cctccaggaa gggaatctca ggcatgaacc     10620
     cctctttcaa cctcagctct cgggtgagtg gggaaaaagc attgcacggc tccattgctg     10680
     aaggaagcag agatcagttc tgttctttat cagcctaaga tgcagcctct caccataatt     10740
     tttctctcct ggacttaaag gaaggaggcc agcaacctgg gataacttgt cctttacccc     10800
     cacagggttc ctgacctcac cgaaaagact aatgtgcctt agaacaagca tttgctgtgt     10860
     tttgttagca cctggttcca ggacagaccc tcagcttccc aagaggatac tgctgccaag     10920
     aagttgctct gaagtcagtt tctatcgttc tgctctttga ttcaaagcac tgtttctctc     10980
     actgggcctc caaccatgtt cccttcttct tagcaccaca aataatcaaa acccaacata     11040
     agtgtttgtt ttcctttaaa aatatgcatc aaatcgtctc tcattacttt tctctgaggg     11100
     ttttagtaaa cagtaggagt taataaagaa gttcattttg gtttacacgt aggaaagaag     11160
     agaagcatga aagtggagat atgttaacta ttgtataatg tggcctgtta tacatgacac     11220
     tcttctgaat tgactgtatt tcagtgagct gcccccaaat caagtttagt gccctcatcc     11280
     atttatgtct cagaccgcta ttcttaacta ttcaatggtg agcagactgc aaatctgcct     11340
     gataggaccc gtattcccac agcactaatt caacatatat cttactgaga gcatgtttta     11400
     tcattaccat taagaagtta aatgaacatc agaatttaaa atcataaata taatctaata     11460
     cactttaa                                                              11468
//