Dbfetch

ID   LT719007; SV 1; linear; genomic DNA; STD; HUM; 11518 BP.
XX
AC   LT719007;
XX
DT   28-JAN-2017 (Rel. 131, Created)
DT   28-JAN-2017 (Rel. 131, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1674, allele HLA-DPB1*04:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11518
RA   Albrecht V.;
RT   ;
RL   Submitted (25-JAN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RA   Lang K., Schoefl G., Schmidt A., Lange V.;
RT   "Complementing the HLA-DPB1 Database: Full-Length Gene Characterization of
RT   all Common and Well-Documented Alleles";
RL   Unpublished.
XX
DR   MD5; 25a2b048962c15bee5237c0c8e5d21ef.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11518
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1674"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=1
FT   CDS             join(367..466,4997..5260,9267..9548,10096..10206,
FT                   10536..10555)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:I4EC17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:I4EC17"
FT                   /protein_id="SJK83322.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..4996
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=1
FT   exon            4997..5260
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=2
FT   intron          5261..9266
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=2
FT   exon            9267..9548
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=3
FT   intron          9549..10095
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=3
FT   exon            10096..10206
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=4
FT   intron          10207..10535
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=4
FT   exon            10536..11518
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*04:new"
FT                   /number=5
XX
SQ   Sequence 11518 BP; 3133 A; 2537 C; 2987 G; 2861 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgaact       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtgtctt tggggaaaat       720
     gggaccaaga ggtcctggat aaccttggac agacaaggtt tgcagagaga gaagttggca       780
     agtgcaggct cctgggcgtg ttcatgtctg catccagcct ggaggggact caggcagaga       840
     gccctaagct ggagtgtcca ggctctgagg atcactgagg attcagtgct cacgaagaat       900
     gcctcttatt ccccagggtg gagcaggagc ccacatccct tggacaatta aggagagaag       960
     ggagggaggg ggataggttt tagcccctga aggcattctc attaaaggta cttctcccag      1020
     cctccccaga acttggttag ggtactagag tgggttgcga cttgtaggaa gaatgagatg      1080
     aggttgtgtg ggtgcatgac agggattgag tgtaggttat cagacagcca aggaagcagt      1140
     aaccaagtga aaaatctctt cttcctgctg cctccctgtg gctggtgtaa tattatggca      1200
     tctatgatcc attgtttttc tctcaggata ctctcaggat atttcttttt atatatatat      1260
     atactttaag ttctagggta catgtgcaca acgtgcaggt ttgttacata tgtatacatg      1320
     tgccatgttg gtgtgctgca cccattaact cgtcatttac attaggtata tttcctaatg      1380
     ctatccctcc cccctccccc caccccacaa caggccccgg tgtatgatgt tccccttcct      1440
     gtgtccatgt gttctcattg ttcagttccc acctatgagt gagaacatgt ggtctttggt      1500
     tttttgtcct tgcaatagtt tgctgtgaat gatgatttcc agcttcctcc atgtccctac      1560
     aaaggacatg aactcatcct tttttatggc tgcacagtat tccatggtgt atatgtgtgc      1620
     attttcttaa tccagtctat cactgatgga cagttgggtt ggttccaagt ctttgctatt      1680
     gtgaatagtg ccgcaataaa catatgtgtg catgtgtctt tatagcagca tgatttataa      1740
     tcctttgggt atatatccag taatgggatg gctgggtcaa atggtatttc tagttctaga      1800
     tctttgagga attgccacac tgtcttgaga taccatctca caccagttaa aatggcgatc      1860
     attaaaaagt caggaaacaa caggtgctgg agaggatgtg gagaaatagg aacactttta      1920
     ctctgttggt gggactgtaa actagttcaa ccattgtact ctcaggacat ttctagtcca      1980
     aatttacacc aacactctga gaggaaggac tgcaaagtag gtaccttagt tttccactga      2040
     cttccacttt tcctgcttac acccttcctc ctagacctct ccacacccct cctaggacac      2100
     acctagaagg tactgacatc atgtcacctc ctcatctttc agggtagcaa ggttggaatc      2160
     tcctgaatac agcccctcaa gccctaaaac ctcttatcta ttaccttggg ttcattgtcc      2220
     aggaagggga ggagaacttg aacttgtagt cacagaaggg tgctgagaac taaccagcag      2280
     gacggctcag ccctgggaac tgcagagggg tgaggctggg gagagaggag gctggagcag      2340
     cactggtgac actgaacagt gtcaggagga agtgacggat gcagcgcccc catcccatag      2400
     gcagagctgt catgtgggat gagggacagt gttgggagcc accaaggaaa cccagaggtg      2460
     ggggagcaga gagcagaagg gggcatgtga tgctgggcag tgaaagggag gacgggcaaa      2520
     ggctgggttg aggtttgtag ggggaatgag atgaggcagt ggagccatgt gacagggact      2580
     gagggtagat tactggagct ccctgcgtag aatgaatgtt caatcaaaac ctgctggagg      2640
     gagagctgga gccatagggg agtgggtaaa gtgggcaggg ctgattccac aattccctgc      2700
     atgctccccc aactccacac acatccccaa cctcaaacag ggcacaagac caaagggctg      2760
     aggagccagg ctatagctta aagaggctgg gggagaaaag cttggctgag acaacccata      2820
     gggagctaga ggtttttaat atatcctatt ctgaataaga gacgaattca ttcagatcag      2880
     tggtttcaaa ccgtgctctg ggcaactcaa ttgctaaggg ttccacaaac aggataaagt      2940
     ttcttatata caaaaaaaaa tgaaggtttc aaattacacc ataaaacccc tcattgctta      3000
     tgtctacttg gcaggtaaaa ttccatttca aaagttaaat gtacttaaaa aattacctaa      3060
     gactgggtaa attaaaaaaa ttaaatgttg caaagaaaaa attcaaaatt cttattcttg      3120
     aatgaaaaac gttctcttac tggtgattga ggaggagaaa caaagactaa caaatgaaaa      3180
     tgggagaatc cacactcaga gtggggcaat tgaacaggca ggggcggatg gatggcagag      3240
     gaggaggaat ctggactcaa ggagctgggg ggctctgggc ctggaatttt agggtctggg      3300
     gcccaaggca ccaggagaag aggcaggtca ggatatctga gtcaagacct gggatcttgc      3360
     cttagcaatg acactggaga ctaaaggtgg actccatggt gcccttgagc ccagccctac      3420
     cccatctcca ctatcctctg ccaccagctg tgcaacttct gctaggggtg aggttaataa      3480
     actggagaag ttaatttgtg gagcatgaaa cagatgagca gaacaatcac agcaccttaa      3540
     tttccccagt gtgcccaaga acagagcagg cctgaagata ctcaaacaga aacaaacatg      3600
     tgccgtgtca ctgataattc tgtgtagaca cacacctgcc agacactgct catggcactc      3660
     cctaggaaga acagcatgtg ggaaaggctg ccaaaattgt tcatgtaaaa attacatcaa      3720
     tgctgtcttc ctcggtgctg cctatgcagc tggcagccat ctcttcctcc acatcatggc      3780
     ctccctcaga ctcctcatga aggataagat cctcaaaaag aggaccaaca agttcatgag      3840
     gcaccaatca gactgaaatg tcaaaattaa gcataactgg cggaaaccca gaggtcttaa      3900
     cagtagggtt cgtagaaggt ccaagggcca gatcttgatg cccaacattg cttatgggag      3960
     caacaacaac aacaaaaaaa acatgctgcc cagtggcttc cagaagtttc tggtccacag      4020
     cctcaaggag ctgaaagtgc tgctgatgtg caacaaatct tactgtgctg agatcgctca      4080
     caaaatttcc tccagaactg caaagtcatc atggaaagag tcacccagcc ggccatcaga      4140
     gtcaccaacc ccagtaccag ggtgcacagc taagaaaatg agtagaaagt tcatgtccac      4200
     gttttgtgtg taaataaaac cataaaaact gccaaaaaaa attacatcaa tgcctctaaa      4260
     cccaaaggac tctaccccca caggtccctg gttgttgtgg tgattttcat tgtgtaaaat      4320
     actttccaca tcttttgaca ccaagtcttt ctgcagccat gtttgaaaat taactttcag      4380
     gctacagagt ctttcttata ccaaagttga agaaagtttt aagaaatata tttctacatc      4440
     tcctacatgc aaaacaacag gagcaagttg aggaattctc aagaaactgg tcgagaagag      4500
     agagcgctta gctatggaaa agagaaagaa ggaagggagg gcttcctgga ggaggtggca      4560
     tttgaaccag gactgacatc aggatggaaa tgtcagtcag ggagttaagt agggggagca      4620
     gctccgccct ccacgtcccc agctcctccc gcccctgttt tttctcccag tgaccccacg      4680
     tgaaacgtct ccgcctcctc cagccaccag cagaagggac tgccttcccc tcagtgctcg      4740
     cccctcccta gtgatcactc agtgcccctg agctcattct tttcagtaaa ttctctctct      4800
     gcgtggtgag aaaacaggcc tggagaggct ctgcgacccg cttaggacca cagaactcgg      4860
     tactaggaaa actcctattt taaaatccag ccctgggtgg gaagatttgg gaagaatcgt      4920
     taatattgag agagagaggg agaaagagga ttagatgaga gtggcgcctc cgctcatgtc      4980
     cgccccctcc ccgcagagaa ttaccttttc cagggacggc aggaatgcta cgcgtttaat      5040
     gggacacagc gcttcctgga gagatacatc tacaaccggg aggagtacgc gcgcttcgac      5100
     agcgacgtgg gggagttccg ggcggtgacg gagctggggc ggcctgctgc ggagtactgg      5160
     aacagccaga aggacatcct ggaggagaag cgggcagtgc cggacaggat gtgcagacac      5220
     aactacgagc tgggcgggcc catgaccctg cagcgccgag gtgagtgagg gctttgggcc      5280
     ggcggtccca gggcagcccc gcgggcccgt gcccagggcg caggagcagc cgggttggcc      5340
     taagggacct tagtgccggg cggaaagggg actttgggtt ggggattcat ggggggagcc      5400
     catctggagc ttgtcagggg agcgagcgcg gggacctgga ctgggctgag catggagtga      5460
     ggaggacgag agcagagaga cccccgggac ttcatcaggc ctggcagctg actgcatgtg      5520
     gggtgaaaaa aggaagccac aggacagcgc acaagggtat ggtgtggaga tggaggtgga      5580
     gatggcacag caggccacac agagaagaaa cctacaggga ggtagctggg tttgaggtgc      5640
     ttgaggggca gatgggtggt ctgatgggca ggtagacaga agggtctgca gccggggagg      5700
     agactgagat acatgagacc atccagggag aggggaccca gggggaagag caaaggaccg      5760
     gatcctggga actggacagt tgtgatttgg ccaagacaga aaagcctgtg aaagagacca      5820
     aaaaaaccca agtgcagtgt gaggagaggc ccgcagagaa gagtcttgga agctgagggg      5880
     aggtgacctc agcagcacag tggacagcgg tgccagtgac ttgggaaggt cagaaaacag      5940
     aagatggaaa gtgggtttgg aaaccaggga gacctgggga gagcaggttg gccgcagcgg      6000
     caggagctgg aatgggaggg ggtgcatgag gctgagtgtg gcgcatcctc ctcggggctg      6060
     agatggattt tacttgtctt gggttcccca cggctgtcac agggcagtgt ctgagttcat      6120
     tcgtcttttt ccttcaggaa gtctgggtgt aaagggatgg agagaggtga ggtgtgtgca      6180
     gtaagaggat ttctcaagga tgggacagga aggccttgga gctttggctt cctcctgtga      6240
     acttgtgggg tggggagcct ggtgcaccaa cctgagggac ttgagggagt agtatcagga      6300
     tgtgggattg agccctggac cttttttcta gaaagaggaa aaaaatgaag ggaggaggag      6360
     gaggaagctg gggagatcac acctttgatt ttcttgttcc tggaaagtga aaggaagttc      6420
     acctgctatg agtgagaagg tggacacact gggtggggat gaggtgagtg acatgagctt      6480
     aggaaagttg ctgaggtaat tggttgagag aggtgttcaa ataaaaataa cgcaattggc      6540
     aaaaactgtt actaagactt tgtagaggca ccaatcagtg acatggcagc attttctttc      6600
     acagtaatca actgccagat tgcagacagc cctgatgcca gcctaaggag tgtgggtttc      6660
     tcctccaggc ccgcaggtcc ccaacctcac tcctctgaag actcttctgg agatcctctg      6720
     tgatgcacag atctccagac tcagtgcccc cagactcaga ttccctgggt ggggaggtct      6780
     ggggatctct gcttgtaatc agctccctag aggttcccat gtagccagat aagtattgtc      6840
     agaacactga agatttttga aaaatgaaaa agagaaggtt ggagatgtgt cttcagaaga      6900
     ctactaaggg tgctggctag aggagggacc agaggcaggg agatgaggta ggaaactgct      6960
     attatttgtc agggaaattg caatcaaggc atgagttaga acagggaaaa cacagaggca      7020
     agggagaggt ggaaggggga ggaaagaagt agtgacaatt ccagggtgga tgtccaccca      7080
     aatctagaag taattgagca aatgttttct gggcattaga gaaggcaact agaacaaaca      7140
     ggaatccttg ccttggtgaa atgtatttga actgggtcag aaatgaggcc attgggtatc      7200
     aggccttaac tccagcgcac cctggaggtc actgatgtgg ctccaggctg acctgctcct      7260
     gtcaaagaat attgagcaag atgcctctcg tggaatgttc tgggacctta aaacagatac      7320
     ccaagtattc cccctgattt catggttccc agaagctcta tggggaagaa attgtaggta      7380
     attcacaact gagatttaga cataagttga atagtgtaat ggacattgag ttaaccgagg      7440
     taatgaagta gtgagacaca ggtgcccctg aaataaactc acattgaggg aagaggctga      7500
     caatgtggat cagtctgaaa acaaggcaaa aatacaatag ggagtaaggg ttgtgtgtca      7560
     gttcaagact gtacttttac ctggcccagc gccatgttag ggtatttgtg ttctccagga      7620
     agtagaaagg aaagaactga gtgattaggg acctagaaga ctaatttgag acattcctct      7680
     tgatgagctg ttctctaggg tagtcctctg aaagagctgt tctctagtgg atctccctga      7740
     atgaactgtt ctctaggagc acttgaccct tttctgtgtt tgttttttgt tttgtgtttg      7800
     tgtttgtttt tgagacaggt tctcactttg tctcccaggc tggagtgctg tggcaccatc      7860
     atggctcact gcagcctcaa cctcctgggc tcaagtgatc ctcctgcctc agcctcccat      7920
     gtagctagaa ctacagatac acgtaccacc atgtctggct aatttatttt tctttttaga      7980
     gatgggttct cactatgttg cccaggccgg tctcaaaacc ctgggctcaa gtgatcctca      8040
     tgcctcaacc tcccaaagtg ctaagattat aggcatgacc accatgcctg gccttttctg      8100
     ctttctgagg aggaaaaagg tactggtggc agagatccaa aagaaaagtt gccagtggca      8160
     gtgtggaaat tcacctgaga acaacaggac aagctggggc acaaatgcaa agatgcagag      8220
     ggaggcaaca cctggtcatc tgtgagacct tcatgggacc tgaagacgca gcacagagga      8280
     ggaacttgaa aaaggacggg atttctacta ctcaagcatg taggagctca ggatattctg      8340
     taaatatgaa gattttgagt ttttgtaggt gaggtaaaaa aatacatagg ttttttacag      8400
     aataagacat gtaaagctct cttcattttc tttgtatttt catgaagtta ttagattcac      8460
     aggccaccat aatgccattg tctgtatatc ttaatttcaa gatattattt gagtaaattt      8520
     tgcttccttt gtatcaagat agaactttga aaaggtaggt aatttcacag ttgatcaaat      8580
     attctttgcc caaattactt ttggttaaaa tttctcctaa atgtgctaca gagtgcaaac      8640
     tctgtctccc tgccattccg ctatatactt actaactatt attttattca agatcatgca      8700
     tgctctactt gaaggtctat ttctatcttt tcaatgctac ccttacccac tagcctaatc      8760
     acattattcc tattttcaac atctaggaat caattacata gtgaacatgc ctaagaaata      8820
     ataatctggg cagatgcagt ggctcaggcc cgtaatccca gccctttgag aggccaagcg      8880
     ggtggatcac ttgaggtcag gcgttggtca agtgctccta gagaaccagg ctgaccaaca      8940
     tggagaaacc ttgtctctac taataataca aaaattagcc aggtgaagtg gcaggcacct      9000
     ataatcccag ctattcggga ggctgaggaa ggagaattgg ttgaagcccg gaggtggagg      9060
     ttgcagtgag ccaatattgc gccactgcat tccagacttg gcaacagagt gacactccat      9120
     ctcaacaaaa agaaagaatg aaagaaagaa agagcgagat tatgtctcaa aaaaaaggaa      9180
     ggaaggaagg aaggaaggaa ggaaggaagg aaggaaagaa ggacaatctc aaattctatt      9240
     tcattatttt tcttccacgc tcctagtcca gcctagggtg aatgtttccc cctccaagaa      9300
     ggggcccttg cagcaccaca acctgcttgt ctgccacgtg acggatttct acccaggcag      9360
     cattcaagtc cgatggttcc tgaatggaca ggaggaaaca gctggggtcg tgtccaccaa      9420
     cctgatccgt aatggagact ggaccttcca gatcctggtg atgctggaaa tgacccccca      9480
     gcagggagat gtctacacct gccaagtgga gcacaccagc ctggatagtc ctgtcaccgt      9540
     ggagtggagt gagtctctga tgaccctcta gaccccacct ctgaagagca ggggactctc      9600
     tggctctggg gtccactcat cttatcttct gcatctatac cctggggcca tgtccaaacc      9660
     ccatctttct tctataccag ctcctgagca tagtttgaag ccagggaaat ggagacttcc      9720
     tgaccttggc ttaggggttc ctgaagattc atagttctcc cccttgtcag agaatctagg      9780
     gacactgact ggtctcgaaa ccctcacact taggaactga cctcacacat aggaacagtt      9840
     ctcttccttc agcattttag cctcttctca ggcattttga gaggcaactt ccagaatcag      9900
     catttgccac cttgttgagg tcacacccct gttccagata tgagggtggc tctttctgaa      9960
     tttcctctta gcaagctttt tccgctgcac tgtcctcatc ccgatatgct gcatcaggct     10020
     ccagaatctc aggcaggaca tgagtaggga tgcagctggt ggaggtgaca ctaaacctgg     10080
     gtctgtcctt cccagaggca cagtctgatt ctgcccggag taagacattg acgggagctg     10140
     ggggcttcgt gctggggctc atcatctgtg gagtgggcat cttcatgcac aggaggagca     10200
     agaaaggtga gaaagcctgc agggtgagcg ggacttacct tcccctggca tattcacact     10260
     tattccacga tgaggggttt gacagaaaag aaatgtcaga aagctctaga ggccactgat     10320
     atcagataat cggggaacaa acatgaccta tagcgagaga gggatcccag gctgggatct     10380
     taatgcagcc agatgcatga ggtcccaagt actcaggctc ctgcggagcg tccattgagt     10440
     gatgggcaat ggaatttggt gggatggaaa tgtttctcta attatctgag gtggtttcaa     10500
     tggctgatta tataaccttt cgtctttcat ttcagttcaa cgaggatctg cataaacagg     10560
     taatattcct gctttgattt ccttgtgggg tgggttgcag gaggatatga gtcctttctc     10620
     tgcattgtaa cactgaggct cctccaggaa gggaatctca ggcatgaacc cctctttcaa     10680
     tgtcagcctt caggcaagtg gggaaagagc attgcttggc tccattgctg aaggaagcag     10740
     agatcaactc tgttatttat cagcctgaga cgcatcctct caccataatt tttctctcct     10800
     ggacttacag gaaggaggct ggcaacctgg gataacttgt cttttacccc cacagggttc     10860
     ctgagctcac tgaaaagact attgtgcctt aggaaaagca tttgctgtgt ttcgttagca     10920
     tctggctcca ggacagacct tcaacttcca aattggatac tgctgccaag aagttgctct     10980
     gaagtcagtt tctatcattc tgctctttga ttcaaagcac tgtttctctc actgggcctc     11040
     caaccatgtt cccttcttct tagcaccaca aataatcaaa acccaacatg actgtttgtt     11100
     ttcctttaaa aatatgcacc aaatcatctc tcatcacttt tctctgaggg ttttagtaga     11160
     cagtaggagt taataaagaa gttcattttg gtttaaacat aggaaagaag agaaccatga     11220
     aaatggggat atgttaacta ttgtataatg gggcctgtta cacatgacac tcttctgaat     11280
     tgactgtatt tcagtgagct gcccccaaat caagtttagt gccctcatcc atttatgtct     11340
     cagaccacta ttcttaacta ttcaatggtg agcagactgc aaatctgcct gataggaccc     11400
     atattcccac agcactaatt caacatatac cttactgaga gcatgtttta tcattaccat     11460
     taagaagtta aatgaacatc agaatttaaa atcataaata taatctaata cactttaa       11518
//