Dbfetch

ID   LT718992; SV 1; linear; genomic DNA; STD; HUM; 11526 BP.
XX
AC   LT718992;
XX
DT   28-JAN-2017 (Rel. 131, Created)
DT   28-JAN-2017 (Rel. 131, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1658, allele HLA-DPB1*02:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11526
RA   Albrecht V.;
RT   ;
RL   Submitted (25-JAN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RA   Lang K., Schoefl G., Schmidt A., Lange V.;
RT   "Complementing the HLA-DPB1 Database: Full-Length Gene Characterization of
RT   all Common and Well-Documented Alleles";
RL   Unpublished.
XX
DR   MD5; 01288045f9f39691e3ad75e9644219a7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11526
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1658"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=1
FT   CDS             join(367..466,5003..5266,9275..9556,10104..10214,
FT                   10544..10563)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A1C3PI34"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C3PI34"
FT                   /protein_id="SJK83307.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVHQLRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPEAEYWNSQKDILEEERAVPDR
FT                   MCRHNYELDEAVTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5002
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=1
FT   exon            5003..5266
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=2
FT   intron          5267..9274
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=2
FT   exon            9275..9556
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=3
FT   intron          9557..10103
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=3
FT   exon            10104..10214
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=4
FT   intron          10215..10543
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=4
FT   exon            10544..11526
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=5
XX
SQ   Sequence 11526 BP; 3131 A; 2540 C; 2996 G; 2859 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcgcc aaacatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgaact       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     gaaaatggga ccaagaggtc ctggataacc ttggacagac aaggtttgca gagagagaag       780
     ttggcaagtg caggctcctg ggcgtgttca tgtctgcatc cagcctggag gggactcagg       840
     cagagagccc taagctggag tgtccaggct ctgaggatca ctgaggattc agtgctcacg       900
     aagaatgcct cttattcccc agggtggagc aggagcccac atcccttgga caattaagga       960
     gagaagggag ggagggggat aggttttagc ccctgaaggc attctcatta aaggtacttc      1020
     tcccagcctc cccagaactt ggttagggta ctagagtggg ttgcgacttg taggaagaat      1080
     gagatgaggt tgtgtgggtg catgacaggg attgagtgta ggttatcaga cagccaagga      1140
     agcagtaacc aagtgaaaaa tctcttcttc ctgctgcctc cctgtggctg gtgtaatatt      1200
     atggcatcta tgatccattg tttttctctc aggatactct caggatattt ctttttatat      1260
     atatatatac tttaagttct agggtacatg tgcacaacgt gcaggtttgt tacatatgta      1320
     tacatgtgcc atgttggtgt gctgcaccca ttaactcgtc atttacatta ggtatatttc      1380
     ctaatgctat ccctcccccc tccccccacc ccacaacagg ccccggtgta tgatgttccc      1440
     cttcctgtgt ccatgtgttc tcattgttca gttcccacct atgagtgaga acatgtggtc      1500
     tttggttttt tgtccttgca atagtttgct gtgaatgatg gtttccagct tcctccatgt      1560
     ccctacaaag gacatgaact catccttttt tatggctgca cagtattcca tggtgtatat      1620
     gtgtgcattt tcttaatcca gtctatcact gatggacagt tgggttggtt ccaagtcttt      1680
     gctattgtga atagtgccgc tataaacata tgtgtgcatg tgtctttata gcagcatgat      1740
     ttataatcct ttgggtatat acccagtaat gggatggctg ggtcaaatgg tatttctagt      1800
     tctagatcct tgaggaattg ccacactgtc ttgagatacc atctcacacc agttaaaatg      1860
     gcgatcatta aaaagtcagg aaacaacagg tgctggagag gatgtggaga aataggaaca      1920
     cttttactct gttggtggga ctgtaaacta gttcaaccat tgtactctca ggacatttct      1980
     agtccaaatt tacaccaaca ctctgagagg aaggactgca aagtaggtac cttagttttc      2040
     cactgacttc cacttttcct gcttacaccc ttcctcctag acctctccac acccctccta      2100
     ggacacacct aaaaggtact gacatcatgt cacctcctca tctttcaggg tagcaaggtt      2160
     ggaatctcct gaatacagcc cctcaagccc taaaacctct tatctattac cttgggttca      2220
     ttgtccagga aggggaggag aacttgaact tgtagtcaca gaagggtgct gagaactaac      2280
     cagcaggacg gctcagccct gggaactgca gaggggtgag gctggggaga gaggaggctg      2340
     gagcagcact ggtgacactg aacagtgtca ggaggaagtg acggatgcag cgcccccatc      2400
     ccataggcag agctgtcatg tgggatgagg gacagtgttg ggagccacca aggaaaccca      2460
     gaggtggggg agcagagagc agaagggagc atgtgatgct ggacagtgaa agggaggaca      2520
     ggcaaaggct gggttgaggt ttgtaggggg aatgagatga ggcagtggag ccatgtgaca      2580
     gggactgagg gtagattact ggagctccct gcgtagaatg aatgttcaat caaaatttgc      2640
     tggagggaga gctggagcca taggggagtg ggtaaagtgg gcagggctga ttccacaatt      2700
     ccctgcatgc tcccccaact ccacacacat ccccaacctc aaacagggca caagaccaaa      2760
     gggctgagga gccaggctat agcttaaaga ggctggggga gaaaagcttg gctgagacaa      2820
     cccataggga gctagaggtt tttaatatat cctattctga ataagagacg aattcattca      2880
     gatcagtggt ttcaaaccgt gctctgggca actcaattgc taagggttcc acaaacagga      2940
     taaagtttct tatatacaaa aaaaaatgaa ggtttcaaat tacaccataa agcccctcat      3000
     tgcttatgtc tacttggcag gtaaaattcc atttcaaaag ttaaatgtac ttaaaaaatt      3060
     acctaagact gggtaaatta aaaaaattaa atgttgcaaa gaaaaaattc aaaattctta      3120
     ttcttgaatg aaaaacgttc tcttactggt gattgaggag gagaaacaaa gactaacaaa      3180
     tgaaaatggg agaatccaca ctcagagtgg ggcaattgaa caggcagggg cggatggatg      3240
     gcagaggagg aggaatctgg actcaaggag ctggggggct ctgggcctgg aattttaggg      3300
     tctggggccc aaggcaccag gagaagaggc aggtcaggat atctgagtca agacctggga      3360
     tcttgcctta gcaatgacac tggagactaa aggtggactc catggtgccc ttgagcccag      3420
     ccctacccca tctccactat cctctgccac cagctgtgca acttctgcta ggggtgaggt      3480
     taataaactg gagaagttaa tttgtggagc atgaaacaga tgagcagaac aatcacagca      3540
     ccttaatttc cccagtgtgc ccaagaacag agcaggcctg aagatactca aacagaaaca      3600
     aacatgtgcc gtgtcactga taattctgtg tagacacaca cctgccagac actgctcatg      3660
     gcactcccta ggaagaacag catgtgggaa aggctgccaa aattgttcat gtaaaaatta      3720
     catcaatgct gtcttcctcg gtgctgccta tgcagctggc agccatctct tcctccacat      3780
     catggcctcc ctcagactcc tcatgaagga taagatcctc aaaaagagga ccaacaagtt      3840
     catgaggcac caatcagact gaaatgtcaa aattaagcat aactggcgga aacccagagg      3900
     tcttaacagt agggttcgta gaaggtccaa gggccagatc ttgatgccca acattgctta      3960
     tgggagcaac aacaacaaca aaaaacacat gctgcccagt ggcttccaga agtttctggc      4020
     ccacagcctc aaggagctga aagtgctgct gatgtgcaac aaatcttact gtgctgagat      4080
     cgctcacaaa atttcctcca gaactgcaaa gtcatcatgg aaagagtcac ccagccggcc      4140
     atcagagtca ccaaccccag taccagggtg cacagctaag aaaatgagta gaaagttcac      4200
     gtccacgttt tgtgtgtaaa taaaaccata aaaactgcca aaaaaaatta catcaatgcc      4260
     tctaaaccca aaggactcta cccccacagg tccctggttg ttgtggtgat tttcattgtg      4320
     taaaatactt tccacatctt ttgacaccaa gtctttctgc agccatgttt gaaaattaac      4380
     tttcaggcta cagagtcttt cttataccaa agttgaagaa agttttaaga aatatatttc      4440
     tacatctcct aaatgcaaaa caacaggagc aagttgagga attctcaaga aactggtcga      4500
     gaagagagag cgcttagcta tggaaaagag aaagaaggaa gggagggctt cctggaggag      4560
     gtggcatttg aaccaggact gacatcagga tggaaatgtc agtcagggag ttaagtaggg      4620
     ggagcagctc cgccctccac gtccccagct cctcccgccc ctgttttttc tcccagtgac      4680
     cccacgtgaa acgtctccgc ctcctccagc caccagcaga agggactgcc ttcccctcag      4740
     tgctcgcccc tccctagtga tcactcagtg cccctgagct cattcttttc agtaaattct      4800
     ctctctgcgt ggtgagaaaa caggcctgga gaggctctgc gacccgctta ggaccacaga      4860
     actcggtact aggaaaactc ctattttaaa atccagccct gagtgggaag atttgggaag      4920
     aatccttaat attgagagag agagggagaa agaggattag atgagagtgg cgcctccgct      4980
     catgtccgcc ccctccccgc agagaattac gtgcaccagt tacggcagga atgctacgcg      5040
     tttaatggga cacagcgctt cctggagaga tacatctaca accgggagga gttcgtgcgc      5100
     ttcgacagcg acgtggggga gttccgggcg gtgacggagc tggggcggcc tgaggcggag      5160
     tactggaaca gccagaagga catcctggag gaggagcggg cagtgccgga caggatgtgc      5220
     agacacaact acgagctgga cgaggccgtg accctgcagc gccgaggtga gtgagggctt      5280
     tgggccggcg gtcccagggc agccccgcgg gcccgtgccc agggcgcagg agcagccggg      5340
     ttggcctaag ggaccttagt gccgggcgga aaggggactt tgggttgggg attcatgggg      5400
     ggagcccatc tggagcttgt caggggagcg agcgcgggga cctggactgg gctgagcatg      5460
     gagtgaggag gacgggagca gagagacccc cgggacttca tcaggcctgg cagctgactg      5520
     catgtggggt gagaaaagga ggccacagga cagcgcgcaa gggtgtggcg tggagatgga      5580
     ggtggagatg gcacagcagg ccacacagag aagaaaccta cagggaggta gctgggtttg      5640
     aggtgcttga ggggcagatg ggtggtctga tgggcaagta gacaaaaggg tctgcagccg      5700
     gggaggagac tgagatacat gagaccatcc agggagaggg gacccagggg gaagggcaaa      5760
     ggactggatc ctgggaactg gacagttgtg atttggccaa gacagaaaag cctgtgaaag      5820
     agaccaaaaa aacccaagtg cggtgtgagg agaggcccgc agagaagagt cttggaagct      5880
     gaggggaggt gacctcagca gcacagtgga cagcggtgcc agtgacttgg gaaggtcaga      5940
     aaacagaaga tggaaagtgg gtttggaaac cagggagacc tggggagagc aggttggccg      6000
     cagcggcagg agctggaatg ggagggggtg catgaggctg agtgtggctc atcctcctcg      6060
     gggctgagat ggattttact tgtcttgggt tccccatggc tggcacaggg cagtgtctga      6120
     gctcatttgt cttttccttc aggaagtcgg ggtgtaaagg gacggagaga ggtgaggtgt      6180
     gtgcagtaag aggatttctc aaggatggga caggagggcc ttggagcttt ggcttcctcc      6240
     tgtgaatttg tggggtgggg agcctggtgc accaacctga gggacctgag ggagtagtat      6300
     caggatgtgg gattgagccc tggacctttt ttctagaaag aggaaaaaat gaagggagga      6360
     ggaggaggaa gctggggaga tcacaccttt gattttcttg ttcctggaaa gtgaaaggaa      6420
     gttcacctgc tatgagtgag aaggtggaca cactgggtgg ggatgaggtg agtgacatga      6480
     gcttaggaaa gttgctgagg taattggttg agagaggtgt tcaaataaaa ataacgcaat      6540
     tggcaaaaac tgttactaag actttgtaga ggcaccaatc agtgacatgg cagcattttc      6600
     tttcacagta atcaactgcc agattgcaga cagccctgat gccagcctaa ggagtgtggg      6660
     tttctcctcc aggcccgcag gtccccaacc tcactcctct gaagactctt ctggagatcc      6720
     tctgtgatgc acagatctcc agactcactg ccccgagact cagattccct gggtggggag      6780
     gtctggggat ctctgcttgt aatcagctcc ctagaggttc ccatgtagcc agataagtat      6840
     tgtcagaaca ctgaagattt ttgaaaaatg aaaaagagaa ggttggagat gtgtcttcag      6900
     aagactacta agggtgctgg ctagaggagg gaccagaggc agggagatga ggtaggaaac      6960
     tgctattatt tgtcagggaa attgcaatca aggcatgagt tagaacgggg aaaacacaga      7020
     ggcaagggag aggtggaagg gggaggaaag aagtagtgac aattccaggg tggatgtcca      7080
     cccaaatcta gaagtaattg agcaaatgtt ttctgggcat tagagaaggc aactagaaca      7140
     aacaggaatc cttgccttgg tgaaatgtat ttgaactggg tcagaaatga ggccattggg      7200
     tatcaggcct taactccagc gcaccctgga ggtcgctgat gtggctccag gctgacctgc      7260
     tcctgtcaaa gaatattgag caagatgcct ctcgtggaat gttctgggac cttaaaacag      7320
     atacccaagt attccccctg atttcatggt tcccagaagc tctatgggga agaaattgta      7380
     ggtaattcac aactgagatt tagacataag ttgaatagtg taatggacat tgagttaacc      7440
     gaggtaatga agtagtgaga cacaggtgcc cctgaaataa actcacattg agggaagagg      7500
     ctgacaatgt ggatcagtct gaaaacaagg caaaaataca atagggagta agggttgtgt      7560
     gtcagttcaa gactgtactt ttacctggcc cagcgccatg ttagggtatt tgtgttctcc      7620
     aggaagtaga aatgaaagaa ctgagtgatt agggacctag aagactaatt tgagacattc      7680
     ctcttgatga gctgttctct agggtagtcc tctgaaagag ctgttctcta gtggatctcc      7740
     ctgaatgaac tgttctctag gagcacttga cccttttctg tgtttgtttt ttgttttgtg      7800
     tttgtgtttg tttttgagac aggttctcac tctgtctccc aggctggagt gctgtggcac      7860
     catcatggct cactgcagcc tcaacctcct gggctcaagt gatcctcctg cctcagcctc      7920
     ccatgtagct agaactacag atacacgtac caccatgtct ggctaattta tttttctttt      7980
     tagagatggg ttctcactat gttgcccagg ccggtctcaa aaccctgggc tcaagtgatc      8040
     ctcatgcctc aacctcccaa agtgctaaga ttataggcat gaccaccatg cctggccttt      8100
     tctgctttct gaggaggaaa aaggtactgg tggcagagat ccaaaagaaa agttgccagt      8160
     ggcagtgtgg aaattcacct gagaacaaca ggacaagctg gggcacaaat gcaaagatgc      8220
     agagggaggc aacacctggt catctgtgag accttcatgg gacctgaaga cgcagcacag      8280
     aggaggaact tgaaaaagga cgggatttct actactcaag catgtaggag ctcaggatat      8340
     tctgtaaata tgaagatttt gagtttttgt aggtgaggta aaaaaataca taggtttttt      8400
     acagaataag acatgtaaag ctctcttcat tttctttgta ttttcatgaa gttattagat      8460
     tcacaggcca ccataatgcc attgtctgta tatcttaatt tcaagatatt atttgagtaa      8520
     attttgcttc ctttgtatca agatagaact ttgaaaaggt aggtaatttc acagttgatc      8580
     aaatattctt tgcccaaatt acttttggtt aaaatttctc ctaaatgtgc tacagagtgc      8640
     aaactctgtc tccctgccat tccgctatat acttactaac tattatttta ttcaagatca      8700
     tgcatgctct acttgaaggt ctatttctat cttttcaatg ctacccttac ccactagcct      8760
     aatcacatta ttcctatttt caacatctag gaatcaatta catagtgaac atgcctaaga      8820
     aataataatc tgggcagatg cagtggctca ggcccgtaat cccagccctt tgagaggccg      8880
     agcgggtgga tcacttgagg tcaggcgttg gtcaagtgct cctagagaac caggctgacc      8940
     aacatggaga aaccttgtct ctactaataa tacaaaaatt agccaggtga agtggcaggc      9000
     acctataatc ccagctattc gggaggctga ggaaggagaa ttggttgaag cccggaggtg      9060
     gaggttgcag tgagccaata ttgcgccact gcattccaga cttggcaaca gagtgacact      9120
     ccatctcaac aaaaagaaag aatgaaagaa agaaagagcg agattatgtc tcaaaaaaaa      9180
     ggaaggaagg aaggaaggaa ggaaggaagg aaggaaggaa ggaaagaagg acaatctcaa      9240
     attctatttc attatttttc ttccacgctc ctagtccagc ctagggtgaa tgtttccccc      9300
     tccaagaagg ggcccttgca gcaccacaac ctgcttgtct gccacgtgac ggatttctac      9360
     ccaggcagca ttcaagtccg atggttcctg aatggacagg aggaaacagc tggggtcgtg      9420
     tccaccaacc tgatccgtaa tggagactgg accttccaga tcctggtgat gctggaaatg      9480
     accccccagc agggagatgt ctacacctgc caagtggagc acaccagcct ggatagtcct      9540
     gtcaccgtgg agtggagtga gtctctgatg accctctaga ccccacctct gaagagcagg      9600
     ggactctctg gctctggggt ccactcacct tatcttctgc atctataccc tggggccatg      9660
     tccaaacccc atctttcttc tataccagct cctgagcata gtttgaagcc agggaaatgg      9720
     agacttcctg accttggctt aggggttcct gaagattcat agttctcccc cttgtcagag      9780
     aatctaggga cactgactgg tctcgaaacc ctcacactta ggaactgacc tcacacatag      9840
     gaacagttct cttccttcag cattttagcc tcttctcagg cattttgaga ggcaacttcc      9900
     agaatcagca tttgccacct tgttgaggtc acacccctgt tccagatatg agggtggctc      9960
     tttctgaatt tcctcttagc aagctttttc cgctgcactg tcctcatccc gatatgctgc     10020
     atcaggctcc agaatctcag acaggacatg agtagggatg cagctggtgg aggtgacact     10080
     aaacctgggt ctgtccttcc cagaggcaca gtctgattct gcccggagta agacattgac     10140
     gggagctggg ggcttcgtgc tggggctcat catctgtgga gtgggcatct tcatgcacag     10200
     gaggagcaag aaaggtgaga aagcctgcag ggtgagcggg acttaccttc ccctggcata     10260
     ttcacactta ttccacgatg aggggtttga cagaaaagaa atgtcagaaa gctctagagg     10320
     ccactgatat cagataatcg gggaacaaac atgacctata gcgagagagg gatcccaggc     10380
     tgggatctta atgcagccag atgcatgagg tcccaagtac tcaggctcct gcggagcgtc     10440
     cattgagtga tgggcaatgg aatttggtgg gatggaaatg tttctctaat tatctgaggt     10500
     ggtttcaatg gctgattata taacctttcc tctttcattt cagttcaacg aggatctgca     10560
     taaacaggta atattcctgc tttgatttcc ttgtggggtg ggttgcagga ggatatgagt     10620
     cctttctgtg cattgtaaca ctgaggctcc tccaggaagg gaatctcagg catgaacccc     10680
     tctttcaatg tcagccttca ggcaagtggg gaaagagcat tgcttggctc cattgctgaa     10740
     ggaagcagag atcaactctg ttatttatca gcctgagacg catcctctca ccataatttt     10800
     tctctcctgg acttacagga aggaggctgg caacctggga taacttgtcc tttaccccca     10860
     cagggttcct gagctcactg aaaagactat tgtgccttag aaaaagcatt tgctgtgttt     10920
     cgttagcatc tggctccagg acagaccttc aacttccaaa ttggatactg ctgccaagaa     10980
     gttgctctga agtcagtttc tatcattctg ctctttgatt caaagcactg tttctctcac     11040
     tgggcctcca accatgttcc cttcttctta gcaccacaaa taatcaaaac ccaacatgac     11100
     tgtttgtttt cctttaaaaa tatgcaccaa atcatctctc atcacttttc tctgagggtt     11160
     ttagtagaca gtaggagtta ataaagaagt tcattttggt ttaaacatag gaaagaagag     11220
     aaccatgaaa atggggatat gttaactatt gtataatggg gcctgttaca catgacactc     11280
     ttctgaattg actgtatttc agtgagctgc ccccaaatca agtttagtgc cctcatccat     11340
     ttatgtctca gaccactatt cttaactatt caatggtgag cagactgcaa atctgcctga     11400
     taggacccat attcccacag cactaattca acatatacct tactgagagc atgttttatc     11460
     attaccatta agaagttaaa tgaacatcag aatttaaaat cataaatata atctaataca     11520
     ctttaa                                                                11526
//