Dbfetch

ID   LT718910; SV 1; linear; genomic DNA; STD; HUM; 11530 BP.
XX
AC   LT718910;
XX
DT   28-JAN-2017 (Rel. 131, Created)
DT   28-JAN-2017 (Rel. 131, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DPB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DPB1-1572, allele HLA-DPB1*02:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11530
RA   Albrecht V.;
RT   ;
RL   Submitted (25-JAN-2017) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RA   Lang K., Schoefl G., Schmidt A., Lange V.;
RT   "Complementing the HLA-DPB1 Database: Full-Length Gene Characterization of
RT   all Common and Well-Documented Alleles";
RL   Unpublished.
XX
DR   MD5; 0b89d3245c2edb446675119615b28d13.
DR   Ensembl-Gn; ENSG00000229295; homo_sapiens.
DR   Ensembl-Tr; ENST00000415996; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11530
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DPB1-1572"
FT                   /db_xref="taxon:9606"
FT   exon            1..466
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=1
FT   CDS             join(367..466,5001..5264,9279..9560,10108..10218,
FT                   10548..10567)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q5EP54"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5EP54"
FT                   /protein_id="SJK83225.1"
FT                   /translation="MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECY
FT                   AFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDR
FT                   MCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQ
FT                   EETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSA
FT                   RSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA"
FT   intron          467..5000
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=1
FT   exon            5001..5264
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=2
FT   intron          5265..9278
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=2
FT   exon            9279..9560
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=3
FT   intron          9561..10107
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=3
FT   exon            10108..10218
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=4
FT   intron          10219..10547
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=4
FT   exon            10548..11530
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*02:new"
FT                   /number=5
XX
SQ   Sequence 11530 BP; 3139 A; 2537 C; 2993 G; 2861 T; 0 other;
     taatccctgt agatgggcca gcagaatatt tgagatcacc ttcagagcaa agaaaacgca        60
     taatctcccc aaatatcatg acttatctga ctggttaaaa tgagtatcac tgtctttcct       120
     ccgtcatctt aagtgcatca caggctttat attttcagac ctttcatact aactttctgc       180
     ctagtgagca atgactcata caaagctcag tgtccattgg ttcttttctc agactctgtc       240
     caatcccagg gtcacagaag actacttggg ttcatggtct ctaatatttc aaacaggagc       300
     tccctttagc gagtccttct tttcctgact gcagctcttt tcattttgcc atccttttcc       360
     agctccatga tggttctgca ggtttctgcg gccccccgga cagtggctct gacggcgtta       420
     ctgatggtgc tgctcacatc tgtggtccag ggcagggcca ctccaggtaa gagccgagct       480
     gccattcttg gagggtctgg ctcagggaac aattcctagg ggacgttatc tttaagggat       540
     caaattctga gacaggctgc gggggctcct gccctaaggc agtgtcctct cttcccagct       600
     agagaaagag gttcatcccc tataggatag cttgctaccc tactggccta ttctctctcc       660
     aaggacatgg gtacagtaaa cagagagagg tgcccagtgg tcagtatgct tgtctttggg       720
     gaaaatggga ccaagaggtc caggataacc ttggacagac aaggtttgca gagagagaag       780
     ttggcaagtg caggctcctg ggcgtgttca catctgcatc cagcctggag gggactcagg       840
     cagagagccc taagctggag tgtccaggct ctgaggatca ctgaggattc agtgctcacg       900
     aagaatgcct cttattcccc agggtggagc aggagcccac accccttgga caattaagga       960
     gagaagggag ggagggggat aggttttagc ccctgaaggc attctcatta aaggtacttc      1020
     tcccagcctc cccagaactt ggttagggta ctagagtggg ttgcgacttg taggaagaat      1080
     gagatgaggt tgtgtgggtg catgacaggg attgagtgta ggttatcaga cagccaagga      1140
     agcagtaacc aagtgaaaaa tctcttcttc ctgctgcctc cctgtggctg gtgtaatatt      1200
     atggcatcta tgatccattg tttttctctc aggatactct caggatattt ctttttatat      1260
     atatatatac tttaagttct agggtacatg tgcacaacgt gcaggtttgt tacatatgta      1320
     tacatgtgcc atgttggtgt gctgcaccca ttaactcgtc atttacatta ggtatatttc      1380
     ctaatgctat ccctcccccc tccccccacc ccacaacagg ccccggtgta tgatgttccc      1440
     cttcctgtgt ccatgtgttc tcattgttca gttcccacct atgagtgaga acatgtggtc      1500
     tttggttttt tgtccttgca atagtttgct gtgaatgatg gtttccagct tcctccatgt      1560
     ccctacaaag gacatgaact catccttttt tatggctgca cagtattcca tggtgtatat      1620
     gtgtgcattt tcttaatcca gtctatcact gatggacagt tgggttggtt ccaagtcttt      1680
     gctattgtga atagtgccgc aataaacata tgtgtgcatg tgtctttata gcagcatgat      1740
     ttataatcct ttgggtatat acccagtaat gggatggctg ggtcaaatgg tatttctagt      1800
     tctagatcct tgaggaattg ccacaatgtc ttgagatacc atctcacacc agttaaaatg      1860
     gcgatcatta aaaagtcagg aaacaacagg tgctggagag gatgtggaga aataggaaca      1920
     cttttactct gttggtggga ctgtaaacta gttcaaccat tgtactctca ggacatttct      1980
     agtccaaatt tacaccaaca ctctgagagg aaggactgca aagtaggtac cttagttttc      2040
     cactgacttc cacttttcct gcttacaccc ttcctcctag acctctccac acccctccta      2100
     ggacacacct agaaggtact gacatcatgt cacctcctca tctttcaggg tagcaaggtt      2160
     ggaatctcct gaatacagcc cctcaagccc taaaacctct tatctattac ctcgggttca      2220
     tgtccaggaa ggggaggaga acttgaactt atagtcacag aagggtgctg agaactaacc      2280
     agcaggacgg ctcagccctg ggaactgcag aggggtgagg ctggggagag aggaggctgg      2340
     agcagcactg gtgacactga acagtgtcag gaggaggtga cggatgcggc atccccatcc      2400
     cataggcaga gctgtcatgt gggatgaggg acagtgttgg gagtcaccga ggaaacccag      2460
     aggtggggga gcagagagca gaagggggca tgtgatgctg ggcagtgaaa gggaggacag      2520
     gcaaaggctg ggttgaggtt tgtaggggga atgagatgag gcagtggagc catgtgacag      2580
     ggactgaggg tagattactg gagctccctg cgtagaatga atgttcaatc aaaacctgct      2640
     ggagggagag ctggagccat aggggagtgg gtaaagtggg cagggctgat tccacaattc      2700
     cctgcatgct cccccaactc cacacacatc cccaacctca aacagggcac aagaccaaag      2760
     ggctgaggag ccaggctata gcttaaagag gctgggggag aaaagcttgg ctgagacaac      2820
     ccatagggag ctagaggttt ttaatatatc ctattctgaa taagagacga attcattcag      2880
     atcagtggtt tcaaaccgtg ctctgggcaa ctcaattgct aagggttcca caaacaggat      2940
     aaagtttctt atatacaaaa aaaatgaagg tttcaaatta caccataaaa cccctcattg      3000
     cttatgtcta cttggcaggt aaaattccat ttcaaaagtt aaatgtactt aaaaaattac      3060
     ctaagactgg gtaaattaaa aaaattaaat gttgcaaaga aaaaattcaa aattcttatt      3120
     cttgaatgaa aaacgttctc ttactggtga ttgaggagga gaaacaaaga ctaacaaatg      3180
     aaaatgggag aatccacact cagagtgggg caactgaaca ggcaggggcg gatggatggc      3240
     agaggaggag gaatctggac tcaaggagct ggggggctct gggcctggaa ttttagggtc      3300
     tggggcccaa ggcaccagga gaagaggcag gtcaggatat ctgagtcaag acctgggatc      3360
     ttgccttagc aatgacactg gagactaaag gtggactcca tggtgccctt gagcccagcc      3420
     ctaccccatc tccactatcc tctgccacca gctgtgcaac ttctgctagg ggtgaggtta      3480
     ataaactgga gaagttaatt tgtggagcat gaaacagatg agcagaacaa tcacagcacc      3540
     ttaatttccc cagtgtgccc aagaacagag caggcctgaa gatactcaaa cagaaacaaa      3600
     catgtgccgt gtcactgata attctgtgta gacacacacc tgccagacac tgctcatggc      3660
     actccctagg aagaacagca tgtgggaaag gctgccaaaa ttgttcatgt aaaaattaca      3720
     tcaatgctgt cttcctcggt gctgcctatg cagctggcag ccatctcttc ctccacatca      3780
     tggcctccct cagactcctc atgaaggata agatcctcaa aaagaggacc aacaagttca      3840
     tgaggcacca atcagactga aatgtcaaaa ttaagcataa ctggcggaaa cccagaggtc      3900
     ttaacagtag ggttcgtaga aggtccaagg gccagatctt gatgcccaac attgcttatg      3960
     ggagcaacaa caacaacaaa aaaaacatgc tgcccagtgg cttccagaag tttctggtcc      4020
     acagcctcaa ggagctgaaa gtgctgctga tgtgcaacaa atcttactgt gctgagatcg      4080
     ctcacaaaat ttcctccaga actgcaaagt catcatggaa agagtcaccc agccggccat      4140
     cagagtcacc aaccccagta ccagggtgca cagctaagaa aatgagtaga aagttcatgt      4200
     ccacgttttg tgtgtaaata aaaccataaa aactgccaaa aaaaattaca tcaatgcctc      4260
     taaacccaaa ggactctacc cccacaggtc cctggttgtt gtggtgattt tcattgtgta      4320
     aaatactttc cacatctttt gacaccaagt ctttctgcag ccatgtttga aaattaactt      4380
     tcaggctaca gagtctttct tataccaaag ttgaagaaag ttttaagaaa tatatttcta      4440
     catctcctac atgcaaaaca acaggagcaa gttgaggaat tctcaagaaa ctggtcgaga      4500
     agagagagcg cttagctatg gaaaagagaa agaaggaagg gagggcttcc tggaggaggt      4560
     ggcatttgaa ccaggactga catcaggatg gaaatgtcag tcagggagtt aagtaggggg      4620
     agcagctccg ccctccacgt ccccagctcc tcccgcccct gttttttctc ccagtgaccc      4680
     cacgtgaaac gtctccgcct cctccagcca ccagcagaag ggactgcctt cccctcagtg      4740
     ctcgcccctc cctagtgatc actcagtgcc cctgagctca ttcttttcag taaattctct      4800
     ctctgcgtgg tgagaaaaca ggcctggaga ggctctgcga cccgcttagg accacagaac      4860
     tcggtactag gaaaactcct attttaaaat ccagccctgg gtgggaagat ttgggaagaa      4920
     tcgttaatat tgagagagag agggagaaag aggattagat gagagtggcg cctccgctca      4980
     tgtccgcccc ctccccgcag agaattacct tttccaggga cggcaggaat gctacgcgtt      5040
     taatgggaca cagcgcttcc tggagagata catctacaac cgggaggagt tcgtgcgctt      5100
     cgacagcgac gtgggggagt tccgggcggt gacggagctg gggcggcctg atgaggagta      5160
     ctggaacagc cagaaggaca tcctggagga ggagcgggca gtgccggaca ggatgtgcag      5220
     acacaactac gagctgggcg ggcccatgac cctgcagcgc cgaggtgagt gagggctttg      5280
     ggccggcggt cccagggcag ccccgcgggc ccgtgcccag ggcgcaggag cagccgggtt      5340
     ggcctaaggg accttagtgc cgggcggaaa ggggactttg ggttggggat tcatgggggg      5400
     agcccatctg gagcttgtca ggggagcgag cgcggggacc tggactgggc tgagcatgga      5460
     gtgaggagga cgagagcaga gagacccccg ggacttcatc aggcctggca gctgactgca      5520
     tgtggggtga aaaaaggaag ccacaggaca gcgcacaagg gtatggtgtg gagatggagg      5580
     tggagatggc acagcaggcc acacagagaa gaaacctaca gggaggtagc tgggtttgag      5640
     gtgcttgagg ggcagatggg tggtctgatg ggcaggtaga cagaagggtc tgcagccggg      5700
     gaggagactg agatacatga gaccatccag ggagagggga cccaggggga agagcaaagg      5760
     accggatcct gggaactgga cagttgtgat ttggccaaga cagaaaagcc tgtgaaagag      5820
     accaaaaaaa cccaagtgca gtgtgaggag aggcccgcag agaagagtct tggaagctga      5880
     ggggaggtga cctcagcagc acagtggaca gcggtgccag tgacttggga aggtcagaaa      5940
     acagaagatg gaaagtgggt ttggaaacca gggagacctg gggagagcag gttggccgca      6000
     gcggcaggag ctggaatggg agggggtgca tgaggctgag tgtggcgcat cctcctcggg      6060
     gctgagatgg attttacttg tcttgggttc cccacggctg tcacagggca gtgtctcagt      6120
     tcattcgtct ttttccttca ggaagtctgg gtgtaaaggg atggagagag gtgaggtgtg      6180
     tgcagtaaga ggatttctca aggatgggac aggaaggcct tggagctttg gcttcctcct      6240
     gtgaacttgt ggggtgggga gcctggtgca ccaacctgag ggacttgagg gagtagtatc      6300
     aggatgtggg attgagccct ggaccttttt tctagaaaga ggaaaaaaat gaagggagga      6360
     ggaggaggaa gctggggaga tcacaccttt gattttcttg ttcctggaaa gtgaaaggaa      6420
     gttcacctgc tatgagtgag aaggtggaca cactgggtgg ggatgaggtg agtgacatga      6480
     gcttaggaaa gttgctgagg taattggttg agagaggtgt tcaaataaaa ataacgcaat      6540
     tggcaaaaac tgttactaag actttgtaga ggcaccaatc agtgacatgg cagcattttc      6600
     tttcacagta atcaactgcc agattgcaga cagccctgat gccagcctaa ggagtgtggg      6660
     tttctcctcc aggcccgcag gtccccaacc tcactcctct gaagactctt ctggagatcc      6720
     tctgtgatgc acagatctcc agactcagtg cccccagact cagattccct gggtggggag      6780
     gtctggggat ctctgcttgt aatcagctcc ctagaggttc ccatgtagcc agataagtat      6840
     tgtcagaaca ctgaagattt ttgaaaaatg aaaaagagaa ggttggagat gtgtcttcag      6900
     aagactacta agggtgctgg ctagaggagg gaccagaggc agggagatga ggtaggaaac      6960
     tgctattatt tgtcagggaa attgcaatca aggcatgagt tagaacaggg aaaacacaga      7020
     ggcaagggag aggtggaagg gggaggaaag aagtagtgac aattccaggg tggatgtcca      7080
     cccaaatcta gaagtaattg agcaaatgtt ttctgggcat tagagaaggc aactagaaca      7140
     aacaggaatc cttgccttgg tgaaatgtat ttgaactggg tcagaaatga ggccattggg      7200
     tatcaggcct taactccagc gcaccctgga ggtcactgat gtggctccag gctgacctgc      7260
     tcctgtcaaa gaatattgag caagatgcct ctcgtggaat gttctgggac cttaaaacag      7320
     atacccaagt attccccctg atttcatggt tcccagaagc tctatgggga agaaattgta      7380
     ggtaattcac aactgagatt tagacataag ttgaatagtg taatggacat tgagttaacc      7440
     gaggtaatga agtagtgaga cacaggtgcc cctgaaataa actcacattg agggaagagg      7500
     ctgacaatgt ggatcagtct gaaaacaagg caaaaataca atagggagta agggttgtgt      7560
     gtcagttcaa gactgtactt ttacctggcc cagcgccatg ttagggtatt tgtgttctcc      7620
     aggaagtaga aaggaaagaa ctgagtgatt agggacctag aagactaatt tgagacattc      7680
     ctcttgatga gctgttctct agggtagtcc tctgaaagag ctgttctcta gtggatctcc      7740
     ctgaatgaac tgttctctag gagcacttga cccttttctg tgtttgtttt ttgttttgtg      7800
     tttgtgtttg tttttgagac aggttctcac tttgtctccc aggctggagt gctgtggcac      7860
     catcatggct cactgcagcc tcaacctcct gggctcaagt gatcctcctg cctcagcctc      7920
     ccatgtagct agaactacag atacacgtac caccatgtct ggctaattta tttttctttt      7980
     tagagatggg ttctcactat gttgcccagg ccggtctcaa aaccctgggc tcaagtgatc      8040
     ctcatgcctc aacctcccaa agtgctaaga ttataggcat gaccaccatg cctggccttt      8100
     tctgctttct gaggaggaaa aaggtactgg tggcagagat ccaaaagaaa agttgccagt      8160
     ggcagtgtgg aaattcacct gagaacaaca ggacaagctg gggcacaaat gcaaagatgc      8220
     agagggaggc aacacctggt catctgtgag accttcatgg gacctgaaga cgcagcacag      8280
     aggaggaact tgaaaaagga cgggatttct actactcaag catgtaggag ctcaggatat      8340
     tctgtaaata tgaagatttt gagtttttgt aggtgaggta aaaaaataca taggtttttt      8400
     acagaataag acatgtaaag ctctcttcat tttctttgta ttttcatgaa gttattagat      8460
     tcacaggcca ccataatgcc attgtctgta tatcttaatt tcaagatatt atttgagtaa      8520
     attttgcttc ctttgtatca agatagaact ttgaaaaggt aggtaatttc acagttgatc      8580
     aaatattctt tgcccaaatt acttttggtt aaaatttctc ctaaatgtgc tacagagtgc      8640
     aaactctgtc tccctgccat tccgctatat acttactaac tattatttta ttcaagatca      8700
     tgcatgctct acttgaaggt ctatttctat cttttcaatg ctacccttac ccactagcct      8760
     aatcacatta ttcctatttt caacatctag gaatcaatta catagtgaac atgcctaaga      8820
     aataataatc tgggcagatg cagtggctca ggcccgtaat cccagccctt tgagaggccg      8880
     agcgggtgga tcacttgagg tcaggcgttg gtcaagtgct cctagagaac caggctgacc      8940
     aacatggaga aaccttgtct ctactaataa tacaaaaatt agccaggtga agtggcaggc      9000
     acctataatc ccagctattc gggaggctga ggaaggagaa ttggttgaag cccagaggtg      9060
     gaggttgcag tgagccaata ttgcgccact gcattccaga cttggcaaca gagtgacact      9120
     ccatctcaac aaaaagaaag aatgaaagaa agaaagagcg agattatgtc tcaaaaaaaa      9180
     ggaaggaagg aaggaaggaa ggaaggaagg aaggaaggaa ggaaggaaag aaggacaatc      9240
     tcaaattcta tttcattatt tttcttccac gctcctagtc cagcctaggg tgaatgtttc      9300
     cccctccaag aaggggccct tgcagcacca caacctgctt gtctgccacg tgacggattt      9360
     ctacccaggc agcattcaag tccgatggtt cctgaatgga caggaggaaa cagctggggt      9420
     cgtgtccacc aacctgatcc gtaatggaga ctggaccttc cagatcctgg tgatgctgga      9480
     aatgaccccc cagcagggag atgtctacac ctgccaagtg gagcacacca gcctggatag      9540
     tcctgtcacc gtggagtgga gtgagtctct gatgaccctc tagaccccac ctctgaagag      9600
     caggggactc tctggctctg gggtccactc atcttatctt ctgcatctat accctggggc      9660
     catgtccaaa ccccatcttt cttctatacc agctcctgag catagtttga agccagggaa      9720
     atggagactt cctgaccttg gcttaggggt tcctgaagat tcatagttct cccccttgtc      9780
     agagaatcta gggacactga ctggtctcga aaccctcaca cttaggaact gacctcacac      9840
     ataggaacag ttctcttcct tcagcatttt agcctcttct caggcatttt gagaggcaac      9900
     ttccagaatc agcatttgcc accttgttga ggtcacaccc ctgttccaga tatgagggtg      9960
     gctctttctg aatttcctct tagcaagctt tttccgctgc actgtcctca tcccgatatg     10020
     ctgcatcagg ctccagaatc tcagacagga catgagtagg gatgcagctg gtggaggtga     10080
     cactaaacct gggtctgtcc ttcccagagg cacagtctga ttctgcccgg agtaagacat     10140
     tgacgggagc tgggggcttc gtgctggggc tcatcatctg tggagtgggc atcttcatgc     10200
     acaggaggag caagaaaggt gagaaagcct gcagggtgag cgggacttac cttcccctgg     10260
     catattcaca cttattccac gatgaggggt ttgacagaaa agaaatgtca gaaagctcta     10320
     gaggccactg atatcagata atcggggaac aaacatgacc tatagcgaga gagggatccc     10380
     aggctgggat cttaatgcag ccagatgcat gaggtcccaa gtactcaggc tcctgcggag     10440
     cgtccattga gtgatgggca atggaatttg gtgggatgga aatgtttctc taattatctg     10500
     aggtggtttc aatggctgat tatataacct ttcgtctttc atttcagttc aacgaggatc     10560
     tgcataaaca ggtaatattc ctgctttgat ttccttgtgg ggtgggttgc aggaggatat     10620
     gagtcctttc tgtgcattgt aacactgagg ctcctccagg aagggaatct caggcatgaa     10680
     cccctctttc aatgtcagcc ttcaggcaag tggggaaaga gcattgcttg gctccattgc     10740
     tgaaggaagc agagatcaac tctgttattt atcagcctga gacgcatcct ctcaccataa     10800
     tttttctctc ctggacttac aggaaggagg ctggcaacct gggataactt gtcttttacc     10860
     cccacagggt tcctgagctc actgaaaaga ctattgtgcc ttaggaaaag catttgctgt     10920
     gtttcgttag catctggctc caggacagac cttcaacttc caaattggat actgctgcca     10980
     agaagttgct ctgaagtcag tttctatcat tctgctcttt gattcaaagc actgtttctc     11040
     tcactgggcc tccaaccatg ttcccttctt cttagcacca caaataatca aaacccaaca     11100
     tgactgtttg ttttccttta aaaatatgca ccaaatcatc tctcatcact tttctctgag     11160
     ggttttagta gacagtagga gttaataaag aagttcattt tggtttaaac ataggaaaga     11220
     agagaaccat gaaaatgggg atatgttaac tattgtataa tggggcctgt tacacatgac     11280
     actcttctga attgactgta tttcagtgag ctgcccccaa atcaagttta gtgccctcat     11340
     ccatttatgt ctcagaccac tattcttaac tattcaatgg tgagcagact gcaaatctgc     11400
     ctgataggac ccatattccc acagcactaa ttcaacatat accttactga gagcatgttt     11460
     tatcattacc attaagaagt taaatgaaca tcagaattta aaatcataaa tataatctaa     11520
     tacactttaa                                                            11530
//