Dbfetch

ID   LT578450; SV 1; linear; genomic DNA; STD; HUM; 7126 BP.
XX
AC   LT578450;
XX
DT   02-JUN-2016 (Rel. 129, Created)
DT   13-OCT-2017 (Rel. 134, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DQB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DQB1-1121, allele HLA-DQB1*04:02:01:01
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7126
RA   Albrecht V.;
RT   ;
RL   Submitted (02-MAY-2016) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; https://doi.org/10.1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. -:1-9(2017).
XX
DR   MD5; b6fef8fb426abb4557983900b75b0379.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7126
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DQB1-1121"
FT                   /db_xref="taxon:9606"
FT   exon            1..638
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=1
FT   CDS             join(530..638,2083..2352,4883..5164,5680..5790,6907..6920)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A182AU54"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A182AU54"
FT                   /protein_id="SBO45791.1"
FT                   /translation="MSWKKALRIPGGLRVATVTLMLAMLSTPVAEGRDSPEDFVYQFKG
FT                   MCYFTNGTERVRLVTRYIYNREEYARFDSDVGVHRAVTPLGPPAAEYWNSQKEVLERTR
FT                   AELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRW
FT                   FRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRA
FT                   QSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH"
FT   intron          639..2082
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=1
FT   exon            2083..2352
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=2
FT   intron          2353..4882
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=2
FT   exon            4883..5164
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=3
FT   intron          5165..5679
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=3
FT   exon            5680..5790
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=4
FT   intron          5791..6906
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=4
FT   exon            6907..7126
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*04:02:01:01"
FT                   /number=5
XX
SQ   Sequence 7126 BP; 1813 A; 1647 C; 1708 G; 1958 T; 0 other;
     ttctaagaac tttgctcttc tcaccaaaac ttaaggctcc tcagggtgtg tctaagacaa        60
     cagcagtaaa aatgtctatg acagcaattt tctctcccct gaaatatgat ccccacttaa       120
     tttgccctac tgaaagaatc ccaagtataa aaacaaccag tttttaatca atattacaaa       180
     gatgtttact gttgaatcgc atttttcttt ggcttcttaa aatcccttag gcattcaatc       240
     ttcagctctt ctataattga gaggaagttt tcacctcaaa tgttcatcca gtgcaatttg       300
     aagacgtcac agtgccaggg actggattga gaaccttcac aaaaaaaaat gtctgcctag       360
     agacagatta ggtccttcag ctccagtgct gattggttcc tttccaaagg accatccaat       420
     cctgccacgc agggaaacat ccacaggttt ttattctttc tgccaggtac atcagatcca       480
     tcaggtccaa gctgtgttga ctaccactac ttttcccttc gtctcaatta tgtcttggaa       540
     gaaggctttg cggatccctg gaggccttcg ggtagcaact gtgaccttga tgctggcgat       600
     gctgagcacc ccggtggctg agggcagaga ctctcccggt aagtgcaggg ccactgctct       660
     ccagagccgc cactctggga acaggctctc cttgggctgg ggtaggggga tggtgatctc       720
     catgatctcg gacacaatct ttcatcaaca tttcctctct ttggggaaag agaacgatgt       780
     tgcattccca tttatctttt agtgatgagg tgagcacagt cggatcccca tcctacaggc       840
     ttaagcctgg aagagaagga gagaggagag gaaagaggag acaaagtgta catttactac       900
     cagtgacagg acaaagtgag catggggtta tttttgaaga tacgaatttc tccagagaca       960
     cagcaggatt tgtcatttag gcgtgcccca agactttgcc tggactaaat attatgggat      1020
     cctgcattgg gaaatgtaag gcagcaatgg tgtctgtagt ctccgtattt gaggaaaagt      1080
     tgtctgtatt cctgactgac tggagcgttt gtggaggcaa aatcttggta ctgaaggaag      1140
     ctgactggat gaccacagac agggagtctt caggtttcac tgatttatgg gcaaatggtg      1200
     acttgagtgg gattcagaga cccgagttgg tggactgaat ttagcagaaa ggaggatgta      1260
     aagaagggaa ataacatata ttgtgaaacc actcatttca gacacagcac aatactttac      1320
     ataaattctc tctcactcct tctaacatcc tgtgtgtaga tatcatgatt ttcttttaca      1380
     caattatact tgtgatatgg atattctgtt acatacctgc cctagctggt gactgccaca      1440
     gcttaattgg aatctagttt atcaaattca aaagcttgtg ctctttccat gaataaatgt      1500
     ttctttctag gactcggagg tgtaggtcct ttctaacata aaagtgagtg aacctcacat      1560
     ggcattcgga agggtaaatc caggcatggg aagggaggta ttttaccgag ggaccaagag      1620
     aatacgcata tcagaacgag gacaggctta atttctggac ccgtctcatc attcccttga      1680
     actcacaggt ttatgtggat aattttatct ctgaggtttc caggagctca atggaaaatg      1740
     ggatttcatg cgagagcgcc ctgattccct ctaagtgcag aggtctatgt aaaatcagcc      1800
     cgactgcctc ttccctcggt tcacaggctc cggcagggac agggctttcc gccctttcct      1860
     gcctgcagga aggcggattc ccgaagcccc cagagagggc gggcagggct gggcagagcc      1920
     gccgggcgga tcacaagtct ggagcgccag gcacgggcgg gcgggaactg gaggtcgcgc      1980
     gggcggttcc acagctccgg gccgggtcag ggcggcggct gcgggggcgg ccgggctggg      2040
     gccgggccgg ggcctgactg accggccggt gattccccgc agaggatttc gtgtaccagt      2100
     ttaagggcat gtgctacttc accaacggga cggagcgcgt gcgtcttgtg accagataca      2160
     tctataaccg agaggagtac gcacgcttcg acagcgacgt gggggtgcat cgggcggtga      2220
     cgccgctggg gccgcctgcc gccgagtact ggaacagcca gaaggaagtc ctggagagga      2280
     cccgggcgga gttggacacg gtgtgcagac acaactacca gttggagctc cgcacgacct      2340
     tgcagcggcg aggtgagcgt cgtcgcccgt ctgcgaggcc catccttggc aggggcccag      2400
     agtctctgcg ccaggagggg cgaagggggc gcggcctctg gaacctgagc cttgttcgtt      2460
     ccaccccggc tgacaggagg aggcggtggg ggtgctgggg gctggtgcat cggaggggca      2520
     gggacctagg gcagagcagg gggacaggca gagttggtca agctgcctag tttcgcccca      2580
     tcctccccgt ccgtcggcct cgccctctgc tctgcacgtt cttgcctcgt gccttatgcg      2640
     tttgcctcct cgtgccttac ctttactaag cagttctctc tgcccccaat ttccgccctc      2700
     ttcccctgcc cgcccgcccg gctagcactg ccgcacccgg caaggtccac ctacacagct      2760
     catgcagtgg gaagcttcag acttggcctg atggagttag ggctgcccca caactgcgcg      2820
     cagggcatcc agcaattaca gttgtcaaat aagatatttt gacttttgac ttcaaattat      2880
     tattcatcgt aattctgttt tcttaaatgg ctctcattca tggcggagct ctttgagatg      2940
     agagtgtttt aatcattgca tgcctggtat ctgacacatt gactggcatg tggtatgagc      3000
     tcaatgatct tctgttaaat taatgaataa atgtgctcag ctgccaatcc acttaggctc      3060
     aagggaaagc agaggataaa tagagcctta aaaatggact tttattaatt attttctgtc      3120
     attttgctta attctttaaa gtaaactctt attgacttgg atcttaatag agtttgtgaa      3180
     tacaaagtct gaggaaaaaa gtgtttgcta aaaataaaaa caacacttga atgatgtttg      3240
     taaggcagtt ttaatttctt agaaaagctg aacaaatggc acaatgcaaa gagcagaagt      3300
     tttggaataa atagattgaa gcaattaaat tattggataa aaatagtttc aggttgcttt      3360
     tggcttaggt tctcccctcc ccccatcact atccacttca ggaataaaca ttctgaaagt      3420
     caattttacc catttagtga gcacttattt ctagacagtt accttatcaa ataccgtcta      3480
     tgttacgtca tttaatctca cagttgcctg tgcattagag attagcatca ccactttata      3540
     tatcctaata ttagtacatg acaaacactt taagtaatca gcccacaagt actcaccaag      3600
     accttaagcc tcccaaagta cacaatattc tttatgttct tcactacaca tctatagagt      3660
     caaagggaca taaagccttg ttaaagccag ttttgactag aagcagcaat gagtctcttc      3720
     ctgtttgatc tccatgttaa tgggacaaaa tgatactttc aaggcattga aaatttatga      3780
     ttaatcaatc cctagtctga ctccagtgtt acctatgcag attcacaaaa cttttagttt      3840
     actttaaact cccttgcctt cttttgactc acatcgtagt gccagcaagt acttacattt      3900
     ttgctatttt ggttctattt ccataaaatt tattttatca tcttttctca taagtttgtg      3960
     ccctctattt tactcccagt ctgtgtaaga tgaacaaatc ttataaggcc acatagctga      4020
     ctgtgatttc aggtggactc caggaaggag aaccaaagaa aagttcaagt ccaagcagaa      4080
     accgtgattc cttccggatg atggctcaag agtgcctttt aattggggtg caacctgctg      4140
     acctcagcaa atctcagcta tatttatatg ttcacattac aggctcatta acctaggctg      4200
     atctctgcaa ggatctcaga atattttcta cagataacat acatgataat atctgatttc      4260
     aggacaaaaa agtaattctc aatagcaagg gaatggagta gggtagacag ctagtaatta      4320
     aactcacttg tatgttaaaa ataaattaag gaaaaaaaga aaatgagaga acatattact      4380
     aaataaagaa agcatacatt aaatatttac tatagtttca cactaagaga ataaaggaaa      4440
     tgcaataaag tggcctgaaa gataaaggat gagacgtgta aagagacagg gaaagatgtg      4500
     tcattttttt actatgagca gcagtctgag aagataaagg aatcgagtta tgggcaaaca      4560
     tgatgtttga tcagtgttat ttgttttgaa ggcctgccta cttttgtttc aaatattaca      4620
     gacttttgaa atcacattct ttttgttttt tgctgtctgt tactagatcg cacattctgt      4680
     aaaggcaggg accatggtat gttgtttatc tttggattct cagtgattgt catatttata      4740
     tttgttgaat gaatcttaat ccaagacttg gactccaggt atctttccac tctggttcca      4800
     aggagggacc attcccaatg gtagacgtgc tgtgtggtct cacatctcac tcctgtcttt      4860
     tcctgtctgt tactgccctc agtggagccc acagtgacca tctccccatc caggacagag      4920
     gccctcaacc accacaacct gctggtctgc tcagtgacag atttctatcc agcccagatc      4980
     aaagtccggt ggtttcggaa tgaccaggag gagacaactg gcgttgtgtc cacccccctt      5040
     attaggaacg gtgactggac cttccagatc ctggtgatgc tggaaatgac tccccagcgt      5100
     ggagacgtct acacctgcca cgtggagcac cccagcctcc agaaccccat catcgtggag      5160
     tggcgtaagg ggatattgag tttctgttac tatgggcccc acaagacaaa gggcagagct      5220
     ccttctgacc cattccttcc catctcttat ccctgatgtc actactgagc tggggatcac      5280
     aggagactag agcacctctt gctccatggc aagtgcatca gaagaatcct gatctcatca      5340
     cctttccaga tgctagggaa attattctac gtactgtttc tccagatccc agtcctgata      5400
     gctcggaggg acttattatt agggctggtg actgggatct tagggtttaa ggtatggatg      5460
     agttcctgag gagtggagat ctgcttcccc gctctctcac ctactcacta taccgaagga      5520
     cctattggct ggctttcccc tcccttaggg gtggtctgaa tggaggacta ggttcctttg      5580
     acactttcac ctcctgcatc tcagactgga cttcagctcc tcagcaggga tgctatgggg      5640
     tgtagggaca aacgctgaca ctcaggctct gcttcttagg ggctcagtct gaatctgccc      5700
     agagcaagat gctgagtggc attggaggct tcgtgctggg gctgatcttc ctcgggctgg      5760
     gccttattat ccatcacagg agtcagaaag gtgaggaacc ccaagggaaa aggggaagat      5820
     gggctgtgac ccagaccctc tgttcaggga ggtcctgtct ctagatgtgg ctctttcctc      5880
     ctgaccctga gaggaagaaa actgagctgg aggtgggagg agacaggaca agattggagg      5940
     aggcattgga atctgatttt actagttgaa aggtagccct gtcacacagg tgactgatag      6000
     agcttattcc aggatatact taccattcat catctcattg gctcctttcc aaaagcttcc      6060
     tccattaaga gggtcagagc cttggcctcc ttgccttcta gtgacaattt tctttgtttt      6120
     aggggatttt aaattagggt acttaaggcc ttgaagaaca tgagtggtaa gagaatataa      6180
     ctctaattaa gtcacatgtg tcattttcct ttggggtgaa agagtggctg tttgtgtaat      6240
     gagacctttc tctgcataac ttccttttgt aagacctcaa gggcctccac cagcaggtga      6300
     tatttcagcc atgagccagt gtgggggggc acaggtgtaa gagggaagag catgagctga      6360
     atgcacctga ccacaatggt ctctgttcat ggtatatttg ctgctatgag gatcaagact      6420
     tagggtcgaa gtttgccagt ttctaggaat ctccagaggt tgttccccag aaccaagcct      6480
     taactttggt ggtatcttct tgtgaaatgt gaagccagaa ccacagctta aatgttagac      6540
     aagaggatga tgcccacttt gtgccacatg ttggtggcta ctgcctgtag gcattttcca      6600
     gtgactgaaa gaggctgcta gtggtaggga tgaggtatca tccaattttc taaaaagatt      6660
     gaacccttca tattccccag aagagtaaca gctgttccgc cacttcccac atatctgcat      6720
     caagctgaag ttctgtgtcc tcacgagctg atttcacctt tgcacagatc ttgcgggagg      6780
     tgacaataat acattctgga cctcagcttt ctctgtctga agctgcaggg ggcccctgag      6840
     gggtggggga gattgcaggc ccaccagcgt accctgtgct gatcatccct cttctctctt      6900
     cttcagggct cctgcactga ctcctgagac tattttaact gggattggtt atcacttttc      6960
     tgtaacgcct gcttgtccct gcccagaatt cccagctgcc tgtgtcagcc tgtccccctg      7020
     agatcagagt cctacagtgg ctgtcacgca gccaccaggt catctccttt catccccacc      7080
     tcgaggctga tggctgtgac cctgcttcct gcacttaccc agagcc                     7126
//