Dbfetch

ID   LN999688; SV 2; linear; genomic DNA; STD; HUM; 7113 BP.
XX
AC   LN999688;
XX
DT   15-JAN-2016 (Rel. 127, Created)
DT   21-JUL-2017 (Rel. 133, Last updated, Version 3)
XX
DE   Homo sapiens, HLA-DQB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DQB1-986, allele HLA-DQB1*03:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Albrecht V.;
RT   ;
RL   Submitted (22-DEC-2015) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [3]
RP   1-7113
RA   Albrecht V.;
RT   ;
RL   Submitted (11-MAR-2016) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [4]
RX   DOI; .1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. 90(2):79-87(2017).
XX
DR   MD5; af4553f113ac8bbbf8e8ce603374e8cf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7113
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DQB1-986"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..529
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT   exon            530..638
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=1
FT   CDS             join(530..638,2083..2352,4883..5164,5680..5790,6894..6907)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:K4Q1X7"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:K4Q1X7"
FT                   /protein_id="CUX91081.1"
FT                   /translation="MSWKKALRIPGGLRVATVTLMLAMLSTPVAEGRDSPEDFVFQFKG
FT                   MCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAVTPLGRLDAEYWNSQKDILEEDR
FT                   ASVDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRW
FT                   FRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRA
FT                   QSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH"
FT   intron          639..2082
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=1
FT   exon            2083..2352
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=2
FT   intron          2353..4882
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=2
FT   exon            4883..5164
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=3
FT   intron          5165..5679
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=3
FT   exon            5680..5790
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=4
FT   intron          5791..6893
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=4
FT   exon            6894..6907
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=5
FT   3'UTR           6908..7113
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
XX
SQ   Sequence 7113 BP; 1805 A; 1643 C; 1711 G; 1954 T; 0 other;
     ttctaagaac tttgctcttc tcaccaaaac ttaaggctcc tcagggtgtg tctaagacaa        60
     cagcagtaaa aatgtctatg acagcaattt tctctcccct gaaatatgat ccccacttaa       120
     tttgccctac tgaaagaatc ccaagtataa aaacaaccag tttttaatca atattacaaa       180
     gatgtttact gttgaatcgc atttttcttt ggcttcttaa aatcccttag gcattcaatc       240
     ttcagctctt ctataattga gaggaagttt tcacctcaaa tgttcatcca gtgcaatttg       300
     aagacgtcac agtgccaggg actgaattga gaaccttcac aaaaaaaaat gtctgcctag       360
     agacagatta ggtccttcag ctccagtgct gattggttcc tttccaaagg accatccaat       420
     cctgccacgc agggaaacat ccacaggttt ttattctttc tgccaggtac atcagatcca       480
     tcaggtccaa gctgtgttga ctaccactac ttttcccttc gtctcaatta tgtcttggaa       540
     gaaggctttg cggatccctg gaggccttcg ggtagcaact gtgaccttga tgctggcgat       600
     gctgagcacc ccggtggctg agggcagaga ctctcccggt aagtgcaggg ccactgctct       660
     ccagagccgc cactctggga acaggctctc cttgggctgg ggtaggggga tggtgatctc       720
     catgatctcg gacacaatct ttcatcaaca tttcctctct ttggggaaag agaacgatgt       780
     tgcattccca tttatctttt agtgatgagg tgagcacagt cggatcccca tcctacaggc       840
     ttaagcctgg aagagaagga gagaggagag gaaagaggag acaaagtgta catttactac       900
     cagtgacagg acaaagtgag catggggtta tttttgaaga tatgaatttc tccagagaca       960
     cagcaggatt tgtcatttag gcgtgcccca agactttgcc tggactaaat attatgggat      1020
     cctgcattgg gaaatgtaag gcagcaatgg tgtctgtagt ctccgtattt gaggaaaagt      1080
     tgtctgtatt cctgactgac tggagcgttt gtggaggcaa aatcttggta ctgaaggaag      1140
     ctgactggat gaccacagac agggagtctt caggtttcac tgatttatgg gcaaatggtg      1200
     acttgagtgg gattcagaga cccgagttgg tggactgaat ttagcagaaa ggaggatgta      1260
     aagaagggaa ataacatata ttgtgaaacc actcatttca gacacagcac aatactttac      1320
     ataaattctc tctcactcct tctaacatcc tgtgtgtaga tatcatgatt ttcttttaca      1380
     caattatact tgtgatatgg atattctgtt acatacctgc cctagctggt gactgccaca      1440
     gcttaattgg aatctagttt atcaaattca aaagcttgtg ctctttccat gaataaatgt      1500
     ttctttctag gactcggagg tgtaggtcct ttctaacata aaagtgagtg aacctcacat      1560
     ggcattcgga agggtaaatc caggcatggg aagggaggta ttttaccgag ggaccaagag      1620
     aatacgcata tcagaacgag gacaggctta atttctggac ccgtctcatc attcccttga      1680
     actcccaggt ttatgtggat aattttatct ctgaggtttc caggagctca atggaaaatg      1740
     ggatttcatg cgagagcgcc ctgattccct ctaagtgcag aggtctatgt aaaatcagcc      1800
     cgactgcctc ttccctcggt tcacaggctc cggcagggac agggctttcc gccctttcct      1860
     gcctgcagga aggcggattc cggaagcccc cagagagggc gggcagggct gggcagagcc      1920
     gccgggcgga tcacaagtct ggagcgccag gcacgggcgg gcgggaactg gaggtcgcgc      1980
     gggcggttcc acagctccgg gccgggtcag ggcggcggct gcgggggcgg ccgggctggg      2040
     gccgggccgg ggcctgactg accggccggt gattccccgc agaggatttc gtgttccagt      2100
     ttaagggcat gtgctacttc accaacggga ccgagcgcgt gcggggtgtg accagataca      2160
     tctataaccg agaggagtac gcgcgcttcg acagcgacgt gggggtgtat cgggcggtga      2220
     cgccgctggg gcggcttgac gccgagtact ggaatagcca gaaggacatc ctggaggagg      2280
     accgggcgtc ggtggacacc gtatgcagac acaactacca gttggagctc cgcacgacct      2340
     tgcagcggcg aggtgagcgt cgtcgcccgt ctgcgaggcc catccttggc aggggcccag      2400
     agtctctgcg ccaggagggg cgaagggggc gcggcctctg gaacctgagc cttgttcgtt      2460
     ccaccccggc tgacaggagg cggcggtggg ggtgctgggg gctggtgcat cggaggggca      2520
     gggacctagg gcagagcagg gggacaggca gagttggtca agctgcctag tttcgcccca      2580
     tcctccccgt ccgtcggcct cgccctctgc tctgcacgtt cttgcctcgt gccttatgcg      2640
     tttgcctcct cgtgccttac ctttactaag cagttctctc tgcccccaat ttccgccctc      2700
     ttcccctgcc cgcccgcccg gctagcactg ccgcacccgg caaggtccac ctacacagct      2760
     catgcagtgg gaagcttcag acttggcctg atggagttag ggctgcccca caactgcgcg      2820
     cagggcatcc agcaattaca gttgtcaaat aagatatttt gatttttgac ttcaaattat      2880
     tattcatcgt aattctgttt tcttaaatgg ctctcattca tggcggagct ctttgagatg      2940
     agagtgtttt aatcattgca tgcctggtat ctgacacatt gactggcatg tggtatgagc      3000
     tcaatgatct tctgttaaat taatgaataa atgtgctcag ctgccaatcc acttaggctc      3060
     aagggaaagc agaggataaa tagagcctta aaaatggact tttattaatt attttctgtc      3120
     attttgctta attctttaaa gtaaactctt attgacttga atcttaatag agtttgtgaa      3180
     tacaaagtct gaggaaaaaa gtgtttgcta aaaataaaaa caacacttga atgatgtttg      3240
     taaggcagtt ttaatttctt agaaaagctg aacaaatggc acaatgcaaa gagcagaagt      3300
     tttggaataa atagattgaa gcaattaaat tattggataa aaatagtttc aggttgcttt      3360
     tggcttaggt tctcccctcc ccccatcact atccacttca ggaataaaca ttctgaaagt      3420
     caattttacc catttagtga gcacttattt ctagacagtt accttatcaa ataccatcta      3480
     tgttacgtca tttaatctca cagttgcctg tgcattaggg attagcatca ccactttata      3540
     tatcctaata ttagtacatg ataaacactt taagtaatca gcccacaagt actcaccaag      3600
     accttaagcc tcccaaagta cacaatattc tttatgttct tcactacaca tctatagagt      3660
     caaagggaca caaagccttg ttaaagccag ttttgactag aagcagcaat gagtctcatc      3720
     ctgtttgatc tccatgttaa tgggacaaaa tgatactttc aaggcattga aaatttatga      3780
     ttaatcaatc cctagtctga ctccagtgtt acctatgcag attcacaaaa cttttagttt      3840
     actttacact cccttgcctt cttttgactc acatcgtagt gccagcaagt acttacattt      3900
     ttgctatttt ggttctattt ccataaaatt tattttatca tcttttctca taaatttgtg      3960
     ccctctattt tactcccagt ctgtgtaaga tgaacaaatc ttataaggcc acatagctga      4020
     ctgtgatttc aggtggactc caggaaggag aaccaaagaa aagttcaagt ccaagcagaa      4080
     accgtgattc cttccggatg atggctcaag agtgcctttt aattggggtg caacctgctg      4140
     acctcagcaa atctcagcta tatttatatg ttcacattac aggctcatta acctaggctg      4200
     atctctgcaa ggatctcaga atattttcta cagataacat acatgataat atctgatttc      4260
     aggacaaaaa agtaattctc aatagcaagg gaatggagta gggtagacag ctagtaatta      4320
     aactcacttg tatgttaaaa ataaattaag gaaaaaaaga aaatgagaga acatattact      4380
     aaataaagaa agcatacatt aaatatttac tatagtttca cactaagaga ataaaggaaa      4440
     tgcaataaag tggcctgaaa gataaaggat gagatgtgta aagagacagg gaaagatgtg      4500
     tcattttttt actatgagca gcagtctgag aagataaagg aatcgagtta tgggcaaaca      4560
     tgatgtttga tcagtgctat ttgttttgaa ggcctgccta cttttgtttc aaatattaca      4620
     gacttttgaa atcacattct ttttgttttt tgctgtctgt tactagatcg cacattctgt      4680
     aaaggcaggg accatggtat gttgtttatc tttggattct cagtgattgt catatttata      4740
     tttgttgaat gaatcttaat ccaagacttg gactccaggt atctttccac tctggttcca      4800
     aggagggacc attcccaatg gtagacgtgc tgtgtggtct cacatctcac tcctgtcttt      4860
     tcctgtctgt tactgccctc agtggagccc acagtgacca tctccccatc caggacagag      4920
     gccctcaacc accacaacct gctggtctgc tcagtgacag atttctatcc agcccagatc      4980
     aaagtccggt ggtttcggaa tgaccaggag gagacaactg gcgttgtgtc cacccccctt      5040
     attaggaacg gtgactggac cttccagatc ctggtgatgc tggaaatgac tccccagcgt      5100
     ggagacgtct acacctgcca cgtggagcac cccagcctcc agaaccccat catcgtggag      5160
     tggcgtaagg ggatattgag tttctgttac tatgggcccc acaagacaaa gggcagagct      5220
     ccttctgacc cattccttcc catctcttat ccctgatgtc actactgagc tggggatcac      5280
     aggagactag agcacctctt gctccatggc aagtgcatca gaagaatcct gatctcatca      5340
     cctttccaga tgctagggaa attattctat gtactgtttc tccagatccc agtcctgata      5400
     gctcggaggg actgattatt agggctggtg actgggatct tagggtttaa ggtatggatg      5460
     agttcctgag gagtggagat ctgcttcccc gctctctcac ctactcactg taccgaagga      5520
     cctattggct ggctttcccc tcccttaggg gtggtctgaa tggaggacta ggttcctttg      5580
     acactttcac ctcctgcatc tcagactgga cttcagctcc tcagcaggga tgctatgggg      5640
     tgtagggaca aacactgaca ctcaggctct gcttcttagg ggctcagtct gaatctgccc      5700
     agagcaagat gctgagtggc attggaggct tcgtgctggg gctgatcttc ctcgggctgg      5760
     gccttattat ccatcacagg agtcagaaag gtgaggaacc ccaagggaaa aggggaagat      5820
     gggctgtgac ccagaccctc tgttcaggga ggtcctgtct ctagatgtgg ctctttcctc      5880
     ctgaccctga gaggaagaaa actgagctgg aggtgggagg agacaggaca agattggagg      5940
     aggcattact agctgaaagg tagccctgtc acacaggtga ctgatagagc ttattccagg      6000
     atgtacttac tgttcatcgt ctcattggct cctttccaaa agcttcctcc attaagaggg      6060
     tcagagcctt ggcctccttg ccttctagtg acaatttcct ttgttttagg ggattttaaa      6120
     ttagggtact taaggccttg aagaacatga gtggtaagag aatataactc taattaagtc      6180
     acatgtgtca ttttcctttg gggtgagaga gtggctgttt gtgtaatgag acctttctct      6240
     gcataacttc cttttgtaag acctcaaggg cctccaccag caggtgatat ttcagccatg      6300
     agccagtgtg ggggggcaca ggtgtaagag ggaagagcat gagctgaatg cacctgacca      6360
     caatggtctc tgttcatggt atatttgctg ctatgaggat caagacttag ggtcgaagtt      6420
     tgccagtttc taggaatctc cagaggttgt tccccagaac caagccttaa ctttggtggt      6480
     atcttcttgt gaaatgtgaa gccagaacca cagcttaaat gttagacaag aggatgatgc      6540
     ccactttgtg ccacatgttg gtggctactg cctgtaggca ttttccagtg actgaaagag      6600
     gctgctagtg gtagggatga ggtatcatcc aattttctaa aaagattgaa cccttcatat      6660
     tccccagaag agtaacagct gttccgccac ttcccacata tctgcatcaa gctgaagttc      6720
     tgtgtcctca cgagctgatt tcacctttgc acagatcttg cgggaggtga cgataataca      6780
     ttctggacct cagctttctc tgtctgaagc tgcagggggc ccctgagggg tgggggagat      6840
     tgcaggccca ccagcgtacc ctgtgctgat catccctctt ctctcttctt cagggctcct      6900
     gcactgactc ctgagactat tttaactggg attggttatc acttttctgt aacgcctgct      6960
     tgtccctgcc cagaattccc agctgcctgt gtcagcctgt ccccctgaga tcagagtcct      7020
     acagtggctg tcacgcagcc accaggtcat ctcctttcat ccccacctcg aggctgatgg      7080
     ctgtgaccct gcttcctgca cttacccaga gcc                                   7113
//