Dbfetch

ID   LN999671; SV 1; linear; genomic DNA; STD; HUM; 7231 BP.
XX
AC   LN999671;
XX
DT   15-JAN-2016 (Rel. 127, Created)
DT   21-JUL-2017 (Rel. 133, Last updated, Version 2)
XX
DE   Homo sapiens, HLA-DQB1 gene for MHC class II antigen, cell line
DE   DKMS-LSL-DQB1-1008, allele HLA-DQB1*03:new
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7231
RA   Albrecht V.;
RT   ;
RL   Submitted (22-DEC-2015) to the INSDC.
RL   Research and Development, DKMS LIFE SCIENCE LAB, Fiedler Str. 43, Saxony,
RL   01307 Dresden, GERMANY.
XX
RN   [2]
RX   DOI; .1111/tan.13057.
RX   PUBMED; 28547825.
RA   Albrecht V., Zweiniger C., Surendranath V., Lang K., Schofl G., Dahl A.,
RA   Winkler S., Lange V., Bohme I., Schmidt A.H.;
RT   "Dual redundant sequencing strategy: Full-length gene characterisation of
RT   1056 novel and confirmatory HLA alleles";
RL   HLA. 90(2):79-87(2017).
XX
DR   MD5; b73c54a41734b11c10734aff1d40b93d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7231
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DKMS-LSL-DQB1-1008"
FT                   /db_xref="taxon:9606"
FT   exon            1..635
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=1
FT   CDS             join(527..635,2084..2353,4983..5264,5782..5892,7013..7026)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0A0U5KKF1"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0U5KKF1"
FT                   /protein_id="CUX91064.1"
FT                   /translation="MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKA
FT                   MCYFTNGTERVRYVTRYIYNREEYARFDSDVGVYRAVTPLGPPDAEYWNSQKEVLERTR
FT                   AELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRW
FT                   FRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRA
FT                   QSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH"
FT   intron          636..2083
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=1
FT   exon            2084..2353
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=2
FT   intron          2354..4982
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=2
FT   exon            4983..5264
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=3
FT   intron          5265..5781
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=3
FT   exon            5782..5892
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=4
FT   intron          5893..7012
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=4
FT   exon            7013..7231
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03:new"
FT                   /number=5
XX
SQ   Sequence 7231 BP; 1851 A; 1694 C; 1716 G; 1970 T; 0 other;
     ttctaagaac cttgcttttt tcaccaaaac ttaaggctcc tcaaagtgtg tctaagacaa        60
     cagcagtaaa aatgtctatg acagcaattt tctctcccct gaaatatgat ccccacttaa       120
     tttgccctat tgaaagaatc ccaagtatga aaacaactgg tttttaatca atattacaaa       180
     gatgtttact gttgaatcgc attttttttg gcttcttaaa atcccttagg cattcagtct       240
     tcagctcttc cataattgag aggaaatttt cacctcaaat gttcatccag tgcaattgga       300
     agacgtcaca gtgccaggca ctggattgag aaccttcaca aaaaaaaatc tgcccagaga       360
     cagatgaggt ccttcagctc cagtgctgat tggttccttt ccaagggacc atccaatcct       420
     accacgcatg gaaacatcca caggttttta ttctttctgc caggtacatc agatccatca       480
     ggtccgagct gtgttgacta ccactacttt tcccttcgtc tcaattatgt cttggaaaaa       540
     ggctttgcgg atccccggag gccttcgggc agcaactgtt accttgatgc tggcgatgct       600
     gagcacccca gtggctgagg gcagagactc tcccggtaag tgcagggcag ctgctctcca       660
     gagccgccac tctgggaaca gactctcctt gggctggggt atggggatgg tgatctcgat       720
     tatctcagac acaatcttta tcaatatttc ctctgttttg ggaaagagag ctatgttgca       780
     ttcccattta tcttttaatg atgaggtgag gacaatccaa tcccatccta cagacttaag       840
     cctggaagag gagagaggag agaaaagagg agacaaagtg ttcatttact accagtgata       900
     ggacaaagtg agcatggggt tatttttgaa gatatgaatt tctccaaaga cacagcatga       960
     tttgtcattt aggcgtgccc caagactgcc tggactaact attatgagat cctgcactgg      1020
     gaaatgtaag gcagcaatgg tgtctgtagt ccccgtattt ggggaaaagg tgtctgtatt      1080
     cctgactcag tggagcgttt gtggaggcaa aatcttggta ctgagggaag ctgactggct      1140
     gaccacagac agggagtctt caggtttcac tgatttatgg gcaaatggtg acctgagtgg      1200
     gattcagaga cccgagttga tggtggacta aatttagtag aaaggaggat gtaaagaaga      1260
     gaaattatac atactgtgaa accactcatt tcagacacag aacaatactt tacataaatt      1320
     ctctctcact ccttctaaca tcctgtgtgt agatatcatg attttctttt acacaattat      1380
     acttgtgaca tggatattct gttacgtaac ctgcccgagc tggtgactgc cacagtttaa      1440
     tgggattcta gtttatcaaa ttcaaaagct tgtgctcttt cagtgaataa acgtttcttt      1500
     ctaggactca gagatctagg actcccttct ttctaacaca gaagtgagtg aacctcacag      1560
     ggcacttggg agggtaaatc caggcatggg aaggaaggta ttttacccag ggaccaagag      1620
     aataggcata tcaaaagagg acaggtttaa ttcctggacc tgtctcgtca ttcccttgaa      1680
     ctctcaggtt tatgtggata actttatctc tgaggtaccc aggagctcca tggaaaatgg      1740
     gatttcatgc gagaacgccc tgatccctct aagtgcagag gtccatgcaa aatcaacccg      1800
     actgcctctt cgcttggttc acaggcccag ccagacaggg acagggcttt cctccctttc      1860
     ctgcctgtag gaaggcggat tcccgaagac ccccgagagg gcgggcaggg ctgggcagag      1920
     cccccgggag gatcccaggt ctgcagcgcg aggcacgggc cggcgggaac tggaggtcgc      1980
     gcgggcggtt ccacagctcc gggccgggtc agggcggcgg ctgcggggtg gccgggctgg      2040
     ggccgggccg gggccggact gaccggccgg tgattccccg cagaggattt cgtgtaccag      2100
     tttaaggcca tgtgctactt caccaacggg acggagcgcg tgcgttatgt gaccagatac      2160
     atctataacc gagaggagta cgcacgcttc gacagcgacg tgggggtgta ccgggcggtg      2220
     acgccgctgg ggccgcctga cgccgagtac tggaacagcc agaaggaagt cctggagagg      2280
     acccgggcgg agttggacac ggtgtgcaga cacaactacc agttggagct ccgcacgacc      2340
     ttgcagcggc gaggtgagcg tcgtcgcccc gctgcgaggc ccactcttgg ccggggcccc      2400
     gagtctctgc gctaggaggg acgagggggg cgaagcctct ggaacctgag ccgcgttcgt      2460
     tccaccccag gggacaggag ttggcggcgt gggtggtggg gcaggtgcat aggaggggca      2520
     gggacctagg ggcagagcag gggtacaggt agagttggtc aaactgccta gttttgcccc      2580
     agccttcccg tccgtcagcc tcgccctctg ctgtgcacgt tctcgcctcg tgccttatgc      2640
     gtttgcctcc tcgtgccttg cctttgctaa gcagtcctct ctgcccccaa tttctgccct      2700
     cttcccctgc ccgcccgccc cgctagcact gccccaccca gcaaggtcca cgtgcactgc      2760
     tcgcgccgca ggaagcttca ggcttggcct ggtggagtta gggctgctcc acaactgtgc      2820
     gcagggcatc cagcaattac agttgtgaaa taagatattt tgacttttgg cttcaaatta      2880
     ttattcatcg taattccgtt ttcttaaatg gctctcattc atggcggagc tctttgaggt      2940
     gagagtgttt taatcatttt atggccggta cctgacacat tgactggcat gtggtataag      3000
     ctcaataatc ttctgttaaa ttaatgaata aatgtgctca gctgccaatc cacttaggct      3060
     caagaaaaac cagaggtaaa cagaacctta aaaatggact tttattaatt attttctatc      3120
     attttgctta attctttaaa gtaaactctt attgacttgg atctaaatag tttgtgaata      3180
     caaagtctga ggaaaaaagt gtttgctaaa aataaaaaca acacttgaat gatgtttgta      3240
     aggcagtttt aatttcttag aaaagctgaa caaatggcac aatgcaaaga gcagaagttt      3300
     tggaataaat agattgaagc cattaaatta ttggataaaa atagtttcag gttgcttttg      3360
     gcctaggttc tcccctcccc ccatcactat ccacttcagg aataaacatt ctgaaagtta      3420
     attttaccca tatagtgagc acttatttct aagttgcctt atcaaatacc atctatgtta      3480
     tgtcatttaa tctcgcagtt gcctgtgcat tagagattag catcaccact ttatatatcc      3540
     taatattagt acatgataaa cactttaagt aatcagccca caagtactca ccaagacctt      3600
     aagcctccca aagtacacaa cattcttacg ttcctcacta cacatctgta gagtcaaagg      3660
     gacataaagc cttgttaaag ccagttttga ccagaagcag caatggtctc ttcctgtttg      3720
     atctccatgt taatgggaca aaatgatact ttcaaggcat tgaaaattta tgattaatca      3780
     atcaaattta tgattaatca atccctagtc tgactccagt gagattcaca aaactttcag      3840
     tttactttat actcccttgc cttcttttga ctcacatcat agtgccagca agtacttata      3900
     tttttgctat ttcagttcta tttccataaa atttatttta tcatcttttc tcataaattt      3960
     gtgccctcta tttttactcc caatctgtgt aagatgaaca aatcttataa gaccacatag      4020
     ctgactgtga tttcaggtgg actccaggaa ggagaaccaa agaaaacttt cagtcttttt      4080
     aagatgaaca aatcttgtaa gtccccacat agctgactgt gatttcaggt ggactccagg      4140
     aaggagaacc aaagaaaagt tcaagtccaa gcagaaaccg tgattccttc cggatgatgg      4200
     ctcatgagtg ccatttaatt ggggtgccac ctgctgtcct cagcaaatcc cagctatatg      4260
     tatatgttcg cattacaggc tcattaacct aggctgacct ctgcaaggat ctcagaatat      4320
     tttctacaga gaacatacat gataatatct gattttagga caaaaaagta attctcaata      4380
     gcaagggaat ggagtagggt agacagctag taattaaact cacttgtgtg ttaaaaataa      4440
     attaaggaaa aaagaaaatg agagaacata ttactaaata aagaaagcat acattaaata      4500
     tttactatag ttttacacta agagaataaa ggaaatgcaa taaagtggcc tgaaaggtaa      4560
     aggatgagat gtgtaaaaga ggcggggaaa gatgtgtcat ttttttttta ctatgagcag      4620
     caatctgaga agataaagga atcgagttat gggcagacat gatgtttgat cagtgttatt      4680
     tgttttcaag gcctgcctac ttttttttca aatattacaa acttttgaag tcacattctt      4740
     tttgtttttt gctgtctgtt actagatcgc acattctgta aaggcaggga ccatggtatg      4800
     ttgtttatct ttggattctc agtgattgtc atatttatgt ttgttgaatg aatcttaatc      4860
     caagacttgg gctccaggta tctttccatt ctggttccaa ggagggacct tcctcacagc      4920
     aggcgtgctg tgtggtctca catctcactc ctatatcttt ccctgtctgt tactgccctc      4980
     agtggagccc acagtgacca tctccccatc caggacagag gccctcaacc accacaacct      5040
     gctggtctgc tcagtgacag atttctatcc agcccagatc aaagtccggt ggtttcggaa      5100
     tgaccaggag gagacaaccg gcgttgtgtc cacccccctt attaggaacg gtgactggac      5160
     cttccagatc ctggtgatgc tggaaatgac tccccagcat ggagacgtct acacctgcca      5220
     cgtggagcac cccagcctcc agaaccccat caccgtggag tggcgtaagg ggatattgag      5280
     tttctgttac tatgggcccc acaagacaaa gggcagagct cattctgacc catcccttcc      5340
     catctcttat ccctgatgtc actactgagc tgggaatcac aggagactag agcacttctt      5400
     cctccatggc aagtgcatca gaagaatcct gatctcatca cctttccaga tgctagggaa      5460
     attactctac atactgtttc tctggatccc agtcctgata gctcggaggg actgatcatt      5520
     agggctggtg actgggatct tagggtttaa ggttatggat gagctcctga ggagtggaga      5580
     tctgcttctc cactctctca cctactcact gtacccaagg acctattggc tggcctttcc      5640
     cctcccttag gggtggtctg aatggaggac tagtttcctt tgacgccttc acctcctgaa      5700
     tctcagactg gacttcagct cctcagcagg gatgctatgg ggtgtgggga caaacactga      5760
     cactcaggct ctgcttctta ggggctcagt ctgaatctgc ccagagcaag atgctgagtg      5820
     gcattggagg cttcgtgctg gggctcatct tcctcgggct gggccttatt atccatcaca      5880
     ggagtcagaa aggtgaggaa ccccaaggga aaaggggaag atgggctgtg acccagaccc      5940
     tctgttcaga gaggtcctgt ctctagatgt ggctctttcc tcctgacccc gagaggaaga      6000
     aagctgagct ggaggtggga ggagacagga caagattgga ggaggcattg gaatctgatt      6060
     ttactagttg aaaggtagcc ctgtcacaca gctcactgat agagcttatt gaaggacatc      6120
     cttacctttc atcattgtct cattggctcc tttccaaaag cttcctccat taagagggtc      6180
     agagccttgg cctccttgcc ttctagtgac aatttccttt gttttagggg attttaaatt      6240
     agggtgctta aggccttgaa ggacatgggt gggaagagaa tataactcta attaagtcac      6300
     atgtgtcatt ttccattggg gtgagagagt ggctgtttgt gtaatgagac ctttctctgc      6360
     ataacttcct tttgtaagac ctcaagggcc tccaccagca ggtaatattt cagccgtgat      6420
     ccagtgtggg gagggcacag atgtaagagg gaagagcatg agctgagtgt acctgaccac      6480
     agtggtctcc gttcatggta tatttgctgc tatgaggatc aagacttagg ggcgaagttt      6540
     gccagtttct aggaatctcc agaggctgtt ccccagaacc aagccttaac tttggtggca      6600
     tcttcctgtg aaatgtgaag ccagaaccac agcttaaatg ttagacacta ggatgatgcc      6660
     cactttgtgc cacatgttgg tggctactgc ctgtaggcat tttccagtga ctgaaagagg      6720
     ctgctagtgg tagggatgag gtatcatcca atttcctaaa aagaccgaac ccttcatatt      6780
     ccccagaaga gtaacagctg ttcccccacc tccctcacat ctgcatcaag ctgaagttct      6840
     gtgtcttcat gagctgattt cacctttgca cagatcttgg gggaggtgat gacaatacac      6900
     tctggacctc agctttgtct gtctgaagct gcagggggcc cctgaggggt gggggagatg      6960
     gcaggcccac cagcgtaccc tgtgctgatc atccctcttc tctcttctcc agggctcctg      7020
     cactgactcc tgagactatt ttaactggga ttggttatca cttttctgta acgcctgctt      7080
     gtccctgccc agaattccca actgcctgtg tcagcctgtc cccctgagat cagagtccta      7140
     cagtggctgt cacgcagcca ccaggtcatc tcctttcatc cccaccccaa ggcgctggct      7200
     gtgactctgc ttcctgcact gacccagagc c                                     7231
//