Dbfetch

ID   LC315803; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   LC315803;
XX
DT   15-AUG-2017 (Rel. 133, Created)
DT   15-AUG-2017 (Rel. 133, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   HLA-JMDP-R-038.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Shimizu M., Nakajima F., Satake M.;
RT   ;
RL   Submitted (09-AUG-2017) to the INSDC.
RL   Contact:Marie Shimizu Japanese Red Cross Society, Central Blood Institute;
RL   Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan
XX
RN   [2]
RA   Shimizu M., Nakajima F., Satake M.;
RT   "HLA-JMDP-R-038";
RL   Unpublished.
XX
DR   MD5; 3e342c8f27a81800b367dee097e5e8a6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*24:02/A*24:02,B*07:02/B*40:01,C*03:04:01/
FT                   C*07:02,DRB1*01:01/DRB1*JMDP-R-038,JMDP36K0307"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-JMDP-R-038"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A0A224ATS4"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A224ATS4"
FT                   /protein_id="BBA21107.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPL
FT                   QHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSLTSPLTVEW"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 652 BP; 125 A; 141 C; 180 G; 106 T; 100 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tctatcctga ggtgactgtg tatcctgcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcctgacg agccctctca cagtggaatg ga               652
//