Dbfetch

ID   LC315802; SV 1; linear; genomic DNA; STD; HUM; 652 BP.
XX
AC   LC315802;
XX
DT   15-AUG-2017 (Rel. 133, Created)
DT   15-AUG-2017 (Rel. 133, Last updated, Version 1)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds, allele:
DE   HLA-JMDP-R-037.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-652
RA   Shimizu M., Nakajima F., Satake M.;
RT   ;
RL   Submitted (09-AUG-2017) to the INSDC.
RL   Contact:Marie Shimizu Japanese Red Cross Society, Central Blood Institute;
RL   Tatsumi 2-1-67, Koto-ku, Tokyo 135-8521, Japan
XX
RN   [2]
RA   Shimizu M., Nakajima F., Satake M.;
RT   "HLA-JMDP-R-037";
RL   Unpublished.
XX
DR   MD5; f462a153a2b8d1452435fd89445ce40e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..652
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*11:01/A*24:02,B*13:01/B*51:01,C*07:02/
FT                   C*14:02,DRB1*JMDP-R-037/DRB1*12:02:01,JMDP36K0306"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>652)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-JMDP-R-037"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A0A224AUE3"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A224AUE3"
FT                   /protein_id="BBA21106.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRHFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 652 BP; 125 A; 141 C; 177 G; 109 T; 100 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagacacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccatcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgttc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaatg gccaggaaga gaagactggg gtggtgtcca caggcctgat ccacaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagcgtgaca agccctctca cagtggaatg ga               652
//