Dbfetch

ID   L79943; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   L79943;
XX
DT   19-JAN-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens isolate CHI004 putative (HLA-E) gene, HLA-E*0103 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RX   DOI; 10.1007/s002510050271.
RX   PUBMED; 9218527.
RA   Arnaiz-Villena A., Martinez-Laso J., Alvarez M., Castro M.J., Varela P.,
RA   Gomez-Casado E., Suarez B., Recio M.J., Vargas-Alarcon G., Morales P.;
RT   "Primate Mhc-E and -G alleles";
RL   Immunogenetics 46(4):251-266(1997).
XX
RN   [2]
RP   1-546
RX   DOI; 10.1016/S0198-8859(97)00008-6.
RX   PUBMED; 9154460.
RA   Gomez-Casado E., Martinez-Laso J., Vargas-Alarcon G., Varela P.,
RA   Diaz-Campos N., Alvarez M., Alegre R., Arnaiz-Villena A.;
RT   "Description of a new HLA-E (E*01031) allele and its frequency in the
RT   Spanish population";
RL   Hum. Immunol. 54(1):69-73(1997).
XX
DR   MD5; 57c1250c3ff5c02eba0c66d22ee3e0e7.
XX
CC   GSDB:S:135977.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /map="p6"
FT                   /isolate="CHI004"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>546
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0103"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0103"
FT                   /product="MHC antigen"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9MW44"
FT                   /db_xref="IMGT/HLA:E*01:03:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MW44"
FT                   /protein_id="AAF25962.1"
FT                   /translation="SHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMV
FT                   PRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGP
FT                   DGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTC
FT                   VEWLHKYLEKGKETLLHL"
FT   exon            1..270
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0103"
FT                   /number=2
FT                   /note="putative"
FT   exon            271..546
FT                   /gene="HLA-E"
FT                   /allele="HLA-E*0103"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 546 BP; 111 A; 163 C; 181 G; 91 T; 0 other;
     gctcccactc cttgaagtat ttccacactt ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc tgtgggctac gtggacgaca cccagttcgt gcgcttcgac aacgacgccg       120
     cgagtccgag gatggtgccg cgggcgccgt ggatggagca ggaggggtca gagtattggg       180
     accgggagac acggagcgcc agggacaccg cacagatttt ccgagtgaat ctgcggacgc       240
     tgcgcggcta ctacaatcag agcgaggccg ggtctcacac cctgcagtgg atgcatggct       300
     gcgagctggg gcccgacggg cgcttcctcc gcgggtatga acagttcgcc tacgacggca       360
     aggattatct caccctgaat gaggacctgc gctcctggac cgcggtggac acggcggctc       420
     agatctccga gcaaaagtca aatgatgcct ctgaggcgga gcaccagaga gcctacctgg       480
     aagacacatg cgtggagtgg ctccacaaat acctggagaa ggggaaggag acgctgcttc       540
     acctgg                                                                  546
//