spacer

EBI Dbfetch

ID   L79937; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   L79937;
XX
DT   11-DEC-2001 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens (individual isolate 17710) MHC class I mRNA, exons 2 and 3
DE   (HLA-B40012).
XX
KW   cell surface antigen; cell surface glycoprotein; class I gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RX   DOI; 10.1007/s002510050286.
RX   PUBMED; 9218543.
RA   Vargas-Alarcon G., Gomez-Casado E., Martinez-Laso J., Granados J.,
RA   de la Torre C.G., Alegre R., Alcocer-Varela J., Arnaiz-Villena A.;
RT   "Description of a new HLA-B40 allele (B*4011) found in a Mexican individual
RT   of Nahua (Aztec) descent";
RL   Immunogenetics 46(4):359-360(1997).
XX
DR   MD5; c7d270079a5205f41b3bd37771a06647.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /isolate="17710"
FT                   /mol_type="mRNA"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="putative"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I"
FT                   /db_xref="GOA:Q8WLQ8"
FT                   /db_xref="IMGT/HLA:B*40:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLQ8"
FT                   /protein_id="AAL40071.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 546 BP; 113 A; 172 C; 189 G; 72 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatctccca gcgcaagttg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac aagctggagc       540
     gcgctg                                                                  546
//


spacer
spacer