spacer

EBI Dbfetch

ID   L78073; SV 1; linear; genomic DNA; STD; HUM; 723 BP.
XX
AC   L78073;
XX
DT   19-JAN-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens clone 16513.1 HLA-G cell surface glycoprotein (MHC-G) gene,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-723
RX   DOI; 10.1007/s002510050235.
RX   PUBMED; 9089111.
RA   Suarez M.B., Morales P., Castro M.J., Fernandez V., Varela P., Alvarez M.,
RA   Martinez-Laso J., Arnaiz-Villena A.;
RT   "A new HLA-G allele (HLA-G*0105N) and its distribution in the Spanish
RT   population";
RL   Immunogenetics 45(6):464-465(1997).
XX
RN   [2]
RP   1-723
RX   DOI; 10.1007/s002510050271.
RX   PUBMED; 9218527.
RA   Arnaiz-Villena A., Martinez-Laso J., Alvarez M., Castro M.J., Varela P.,
RA   Gomez-Casado E., Suarez B., Recio M.J., Vargas-Alarcon G., Morales P.;
RT   "Primate Mhc-E and -G alleles";
RL   Immunogenetics 46(4):251-266(1997).
XX
DR   MD5; de3b5aeecb8d7d5592216979e0671ed3.
XX
CC   GSDB:S:109847.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..723
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="16513.1"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>723
FT                   /gene="MHC-G"
FT   CDS             join(<1..242,469..>723)
FT                   /codon_start=2
FT                   /gene="MHC-G"
FT                   /product="HLA-G cell surface glycoprotein"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9MW45"
FT                   /db_xref="IMGT/HLA:G*01:05N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MW45"
FT                   /protein_id="AAF25961.1"
FT                   /translation="AVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQE
FT                   GPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYE
FT                   QYAYDGKDYLALNEDCAPGPQRTLRLRSPSASVRRPMWLNKGEPTWRARAWSGSTDTWR
FT                   TG"
FT   exon            1..242
FT                   /gene="MHC-G"
FT                   /product="HLA-G cell surface glycoprotein"
FT                   /number=2
FT                   /note="putative"
FT   intron          243..468
FT                   /gene="MHC-G"
FT                   /number=2
FT                   /note="putative"
FT   exon            469..723
FT                   /gene="MHC-G"
FT                   /product="HLA-G cell surface glycoprotein"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 723 BP; 143 A; 232 C; 250 G; 98 T; 0 other;
     cgccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gccatgggct acgtggacga        60
     cacgcagttc gtgcggttcg acagcgactc ggcgtgtccg aggatggagc cgcgggcgcc       120
     gtgggtggag caggaggggc cagagtattg ggaagaggag acacggaaca ccaaggccca       180
     cgcacagact gacagaatga acctgcagac cctgcgcggc tactacaacc agagcgaggc       240
     cagtgagtaa ccccggccca gggcgcagat cacgaccccc cacctccatg ccccacggac       300
     gccccgggta ctcccgagtc tccgggtctg ggatccaccc cgaggccgcg ggacccgccc       360
     agaccctcta cctgggagaa ccccaggcgc ctttaccaaa atccctgcgg gtgggtccgg       420
     gcgagggcga ggctcggtgg gcggggctga ccgaaggggt ggggccaggt tctcataccc       480
     tccagtggat gattggctgc gacctggggt ccgacggacg cctcctccgc gggtatgaac       540
     agtatgccta cgatggcaag gattacctcg ccctgaacga ggactgcgct cctggaccgc       600
     agcggacact gcggctcaga tctccaagcg caagtgtgag gcggccaatg tggctgaaca       660
     aaggagagcc tacctggagg gcacgtgcgt ggagtggctc cacagatacc tggagaacgg       720
     gaa                                                                     723
//


spacer
spacer