spacer

EBI Dbfetch

ID   L78072; SV 1; linear; genomic DNA; STD; HUM; 725 BP.
XX
AC   L78072;
XX
DT   11-DEC-2001 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens clone CHI525 MHC-G (MHC-G) gene, exons 2, 3 and partial cds.
XX
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-725
RX   DOI; 10.1007/s002510050235.
RX   PUBMED; 9089111.
RA   Suarez M.B., Morales P., Castro M.J., Fernandez V., Varela P., Alvarez M.,
RA   Martinez-Laso J., Arnaiz-Villena A.;
RT   "A new HLA-G allele (HLA-G*0105N) and its distribution in the Spanish
RT   population";
RL   Immunogenetics 45(6):464-465(1997).
XX
DR   MD5; 6e861f0de179ce397659cae48c408867.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..725
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="CHI525"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..725
FT                   /gene="MHC-G"
FT   mRNA            join(<1..242,470..>725)
FT                   /gene="MHC-G"
FT                   /product="MHC-G"
FT   CDS             join(<1..242,470..>725)
FT                   /codon_start=2
FT                   /gene="MHC-G"
FT                   /product="MHC-G"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8WLP2"
FT                   /db_xref="IMGT/HLA:G*01:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLP2"
FT                   /protein_id="AAL40074.1"
FT                   /translation="AVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQE
FT                   GPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLIRGYE
FT                   QYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLE
FT                   NG"
FT   exon            1..242
FT                   /gene="MHC-G"
FT                   /number=2
FT                   /note="putative"
FT   intron          243..469
FT                   /gene="MHC-G"
FT                   /number=2
FT                   /note="putative"
FT   exon            470..725
FT                   /gene="MHC-G"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 725 BP; 145 A; 233 C; 250 G; 97 T; 0 other;
     cgccgtgtcc cggcccggcc gcggggagcc ccgcttcatc gccatgggct acgtggacga        60
     cacgcagttc gtgcggttcg acagcgactc ggcgtgtccg aggatggagc cgcgggcgcc       120
     gtgggtggag caggaggggc cagagtattg ggaagaggag acacggaaca ccaaggccca       180
     cgcacagact gacagaatga acctgcagac cctgcgcggc tactacaacc agagcgaggc       240
     cagtgagtaa ccccggccca gggcgcagat cacgaccccc cacctccatg ccccacggac       300
     gccccgggta ctcccgagtc tccgggtctg ggatccaccc cgaggccgcg ggacccgccc       360
     agaccctcta cctgggagaa ccccaaggcg cctttaccaa aatccctgcg ggtgggtccg       420
     ggcgagggcg aggctcggtg ggcggggctg accgaagggg tggggccagg ttctcacacc       480
     ctccagtgga tgattggctg cgacctgggg tccgacggac gcctcatccg cgggtatgaa       540
     cagtatgcct acgatggcaa ggattacctc gccctgaacg aggacctgcg ctcctggacc       600
     gcagcggaca ctgcggctca gatctccaag cgcaagtgtg aggcggccaa tgtggctgaa       660
     caaaggagag cctacctgga gggcacgtgc gtggagtggc tccacagata cctggagaac       720
     gggaa                                                                   725
//


spacer
spacer