spacer

EBI Dbfetch

ID   L76931; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   L76931;
XX
DT   07-APR-1996 (Rel. 47, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Homo sapiens MHC class I (HLA) mRNA, HLA-B*4801 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RX   DOI; 10.1034/j.1399-0039.1999.530504.x.
RX   PUBMED; 10372543.
RA   Marcos C.Y., Fernandez-Vina M.A., Lazaro A.M., Moraes M.E., Moraes J.R.,
RA   Stastny P.;
RT   "Novel HLA-A and HLA-B alleles in South American Indians";
RL   Tissue Antigens 53(5):476-485(1999).
XX
DR   MD5; 7b114dfc6ba3ba0a3e3e40af1f2b0fa0.
DR   Ensembl-Gn; ENSG00000234745; homo_sapiens.
DR   Ensembl-Tr; ENST00000412585; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /product="MHC class I"
FT                   /note="cell surface glycoprotein; integral membrane
FT                   protein"
FT                   /db_xref="GOA:P30486"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*48:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /protein_id="AAB59617.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   variation       290
FT                   /gene="HLA"
FT                   /replace="c"
XX
SQ   Sequence 546 BP; 111 A; 171 C; 190 G; 74 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatctccca gcgcaagttg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggac aagctggagc       540
     gcgctg                                                                  546
//


spacer
spacer