spacer

EBI Dbfetch

ID   L76133; SV 1; linear; mRNA; STD; HUM; 853 BP.
XX
AC   L76133;
XX
DT   11-DEC-2001 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC lymphocyte antigen (DRB1*1302) mRNA, complete cds.
XX
KW   lymphocyte antigen; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-853
RA   Arnaiz-Villena A., Martinez-Quiles N., De Juan-Echavarri D.,
RA   Martin-Villa M., Martinez-Laso J.;
RT   "New complete sequences of MHC-DR in Spanish family wih Systemic Lupus
RT   erythematosus";
RL   Unpublished.
XX
DR   MD5; 54d7ebb9f997619fa29cfbef8559a74b.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
DR   H-InvDB; HIT000193969_05.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..853
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /haplotype="A23/B49/Cwx/DR13/DRw52/DQ1"
FT                   /dev_stage="adult"
FT                   /clone="3,5,6,7,12,14,17,19, Adela Saez"
FT                   /cell_line="EBV-tramsformed B-cell line"
FT                   /cell_type="B-cell"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             41..841
FT                   /codon_start=1
FT                   /gene="DRB1"
FT                   /product="lymphocyte antigen"
FT                   /function="antigen presentation"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="H-InvDB:HIT000193969_04.4"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /citation=[1]
FT                   /protein_id="AAL40069.1"
FT                   /translation="MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECH
FT                   FFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAV
FT                   DTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS"
XX
SQ   Sequence 853 BP; 177 A; 221 C; 272 G; 183 T; 0 other;
     gcctgctgct ctggcccctg gtcctgtcct gttctccagc atggtgtgtc tgaggctccc        60
     tggaggctcc tgcatggcag ttctgacagt gacactgatg gtgctgagct ccccactggc       120
     tttggctggg gacaccagac cacgtttctt ggagtactct acgtctgagt gtcatttctt       180
     caatgggacg gagcgggtgc ggttcctgga cagatacttc cataaccagg aggagaacgt       240
     gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg gagctggggc ggcctgatgc       300
     cgagtactgg aacagccaga aggacatcct ggaagacgag cgggccgcgg tggacaccta       360
     ctgcagacac aactacgggg ttggtgagag cttcacagtg cagcggcgag tccatcctaa       420
     ggtgactgtg tatccttcaa agacccagcc cctgcagcac cacaacctcc tggtctgttc       480
     tgtgagtggt ttctatccag gcagcattga agtcaggtgg ttccggaatg gccaggaaga       540
     gaagactggg gtggtgtcca caggcctgat ccacaatgga gactggacct tccagaccct       600
     ggtgatgctg gaaacagttc ctcggagtgg agaggtttac acctgccaag tggagcaccc       660
     aagcgtgaca agccctctca cagtggaatg gagagcacgg tctgaatctg cacagagcaa       720
     gatgctgagt ggagtcgggg gctttgtgct gggcctgctc ttccttgggg ccgggctgtt       780
     catctacttc aggaatcaga aaggacactc tggacttcag ccaagaggat tcctgagctg       840
     aagtgcagat gac                                                          853
//


spacer
spacer