Dbfetch

ID   L63544; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   L63544;
XX
DT   16-NOV-2001 (Rel. 69, Created)
DT   18-JUN-2009 (Rel. 101, Last updated, Version 6)
XX
DE   Homo sapiens lymphocyte antigen (HLA-B*3501) mRNA, partial cds.
XX
KW   HLA-B allele; HLA-B*3501 gene; lymphocyte antigen;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Vargas-Alarcon G., Martinez-Laso J., Granados J., Alvarez M.,
RA   Diaz-Campos N., Gomez-Casado E., Alcocer-Varela J., Arnaiz-Villena A.;
RT   "Importance of intron sequences in the generation of new HLA-B alleles";
RL   Unpublished.
XX
DR   MD5; aac00c582a1b9212a506a075179a5e9a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            1..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT                   /product="lymphocyte antigen"
FT                   /db_xref="IMGT/HLA:B*35:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WZ43"
FT                   /protein_id="AAL31312.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT                   /number=2
FT                   /note="alpha 1 domain; putative"
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3501"
FT                   /number=3
FT                   /note="alpha 2 domain; putative"
XX
SQ   Sequence 546 BP; 112 A; 174 C; 187 G; 73 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacat catccagagg atgtatggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//