Dbfetch

ID   L54059; SV 1; linear; genomic DNA; STD; HUM; 1101 BP.
XX
AC   L54059;
XX
DT   26-JUL-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I HLA-Cw*0403 mRNA, complete cds.
XX
KW   antigen presentation; cell surface antigen; cell surface glycoprotein;
KW   class I gene; HLA-Cw*0403 gene; HLA-Cw2/Cw4 gene;
KW   integral membrane protein; major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RA   Little A.-M.M.;
RT   "Identification of a hybrid HLA-C allele in a Papua New Guinea population";
RL   Unpublished.
XX
DR   MD5; 7065dd37520082da1ef1a8d3234f0d0d.
XX
CC   HLA-Cw*0403 was sequenced from an individual from Papua New Guinea.
CC   This allele is a hybrid allele, possessing sequences seen in
CC   HLA-Cw*0401 and
CC   HLA-Cw*02022.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /clone="mp19-34"
FT                   /cell_line="KWO010 - immortal"
FT                   /cell_type="B-LCL"
FT                   /tissue_type="B lymphocyte"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>1101
FT                   /gene="HLA-Cw*0403"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLA-Cw*0403"
FT                   /product="MHC class I"
FT                   /db_xref="GOA:P30504"
FT                   /db_xref="HGNC:HGNC:4933"
FT                   /db_xref="IMGT/HLA:C*04:03:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:1IM9"
FT                   /db_xref="PDB:1QQD"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30504"
FT                   /protein_id="AAB04639.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPSRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
XX
SQ   Sequence 1101 BP; 219 A; 332 C; 374 G; 176 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgctgtgtc ccggcccagc       120
     cgcggagagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc tgaccgagtg       300
     aacctgcgga aactgcgcgg ctactacaac cagagcgagg acgggtctca caccctccag       360
     aggatgtttg gctgcgacct ggggccggac gggcgcctcc tccgcgggta taaccagttc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggatc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagcgg       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgttcagca cgaggggctg ccggagcccc tcaccctgag atggaagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//