spacer

EBI Dbfetch

ID   L49341; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   L49341;
XX
DT   14-FEB-2002 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens major histocompatibility complex (HLA-B) mRNA, HLA-B35 allele,
DE   partial cds.
XX
KW   antigen presentation; major histocompatibility complex;
KW   systemic lupus erythematosus.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Vargas-Alarcon G., Granados J., Martinez-Laso J., Gomez-Casado E.,
RA   Arnaiz-Villena A.;
RT   "A new b35 allele found in a Mexican patients with systemic lupus
RT   erythematosus";
RL   Unpublished.
XX
DR   MD5; b64d18e09260d9ea08d4246ce3e4b2dd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /haplotype="A3, A9, B35"
FT                   /dev_stage="adult"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="putative"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="major histocompatibility complex"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8SP59"
FT                   /db_xref="IMGT/HLA:B*35:17:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SP59"
FT                   /protein_id="AAL77537.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQSMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            271..546
FT                   /gene="HLA-B"
FT                   /number=3
FT                   /note="putative"
XX
SQ   Sequence 546 BP; 112 A; 175 C; 187 G; 72 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacat catccagagc atgtacggct       300
     gcgacgtggg gcccgacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer