spacer

EBI Dbfetch

ID   L47984; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   L47984;
XX
DT   14-FEB-2002 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens major histocompatibility complex class I (HLA-B) mRNA,
DE   HLA-B*52012 allele, partial cds.
XX
KW   lymphocyte antigen; major histocompatibility complex;
KW   major histocompatibility complex class I.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RX   DOI; 10.1007/s002510050227.
RX   PUBMED; 9089103.
RA   Vargas-Alarcon G., Gomez-Casado E., Martinez-Laso J., Granados J.,
RA   Layrisse Z., Alegre R., Arnaiz-Villena A.;
RT   "Differences in intron 2 sequences between B*39061 and B*39062 in
RT   Amerindians: comparison with those of B*3901, B*5101, and B*52012 alleles";
RL   Immunogenetics 45(6):436-439(1997).
XX
DR   MD5; d9927522d6fa8b1135be4bf084bbdc74.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /map="6p"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=1
FT                   /note="alpha 1 domain putative"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="major histocompatibility complex class I"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8SP63"
FT                   /db_xref="IMGT/HLA:B*52:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SP63"
FT                   /protein_id="AAL77532.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            271..>546
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="alpha 2 domain putative"
XX
SQ   Sequence 546 BP; 114 A; 172 C; 188 G; 72 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg ggtctcacac ttggcagacg atgtatggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer