spacer

EBI Dbfetch

ID   L42506; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   L42506;
XX
DT   07-APR-1996 (Rel. 47, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Homo sapiens (clone B503) MHC class I HLA-B*1522 gene (A2 B35 CW1 DR4
DE   DQ3/A24 B40 CW3 DR2 DQ1), partial cds.
XX
KW   cell surface antigen; class I gene; connexin; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RX   PUBMED; 8537113.
RA   Martinez-Laso J., Layrisse Z., Gomez-Casado E., Montoya F., Guedez Y.,
RA   Dominguez E., Varela P., Arnaiz-Villena A.;
RT   "A new HLA-B15 allele (B*1522) found in Bari-Motilones Amerindians in
RT   Venezuela: comparison of its intron 2 sequence with those of B*1501 and
RT   B*3504";
RL   Immunogenetics 43(1-2):108-109(1996).
XX
DR   MD5; ca8a377ac416d057831625b655641b87.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /haplotype="A2 B35 CW1 DR4 DQ3/A24 B40 CW3 DR2 DQ1"
FT                   /dev_stage="adult"
FT                   /clone="B503"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="HLA-B*1522"
FT                   /function="antigen presentation"
FT                   /number=2
FT                   /note="alpha 1 domain; putative"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B*1522"
FT                   /product="major histocompatibility complex"
FT                   /db_xref="GOA:Q29859"
FT                   /db_xref="IMGT/HLA:B*35:43:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q29859"
FT                   /protein_id="AAB00144.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            271..546
FT                   /gene="HLA-B*1522"
FT                   /number=3
FT                   /note="alpha 2 domain; putative"
XX
SQ   Sequence 546 BP; 112 A; 173 C; 191 G; 70 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagtggaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer