Dbfetch

ID   L42146; SV 1; linear; genomic DNA; STD; HUM; 774 BP.
XX
AC   L42146;
XX
DT   13-MAY-1995 (Rel. 43, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1501 allele, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-774
RX   DOI; 10.1016/S0198-8859(97)00090-6.
RX   PUBMED; 9361971.
RA   Wang J., Fernandez-Vina M.A., Lazaro A.M., Shumway W., LeFor W.,
RA   Stastny P.;
RT   "New alleles of the HLA-B15 family";
RL   Hum. Immunol. 55(2):184-189(1997).
XX
RN   [2]
RP   1-774
RA   Wang J., Fernandez-Vina M.A., Lazaro A.M., Shumway W., LeFor W.,
RA   Stastny P.;
RT   ;
RL   Submitted (12-MAY-1995) to the INSDC.
RL   Department of Internal Medicine, University of Texas Southwestern Medical
RL   Center, Dallas, TX 75235-8886, USA
XX
DR   MD5; b94e9f78f75c0613f737370f8b3d2f24.
XX
CC   On May 23, 1995 this sequence version replaced gi:806480.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..774
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="leukocytes"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..257,503..>774)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="cell surface glycoprotein; integral membrane
FT                   protein; major histocompatibility complex"
FT                   /db_xref="IMGT/HLA:B*15:24:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCM0"
FT                   /protein_id="AAK31806.1"
FT                   /translation="RYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAP
FT                   WIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGPDGRL
FT                   LRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLCVEWL
FT                   RRYLENGKETLQR"
FT   exon            <1..257
FT                   /gene="HLA-B"
FT                   /number=2
FT   variation       216..233
FT                   /gene="HLA-B"
FT                   /replace="acctgcggatcgcgctcc"
FT   exon            503..774
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 774 BP; 138 A; 254 C; 281 G; 101 T; 0 other;
     gaggtatttc tacaccgcca tgtcccggcc cggccgcggg gagccccgct tcatcgcagt        60
     gggctacgtg gacgacaccc agttcgtgag gttcgacagc gacgccgcga gtccgaggat       120
     ggcgccccgg gcgccatgga tagagcagga ggggccggag tattgggacc gggagacaca       180
     gatctccaag accaacacac agacttaccg agagaacctg cggatcgcgc tccgctacta       240
     caaccagagc gaggccggtg agtgaccccg gcctgggggg gaggtcacga ctccccatcc       300
     cccacgtacg ggccgggtcg gcccgagtct ccgggtccga gatccgcccc cctgaggccg       360
     ggggacccgc ccaaaccctc gaccggcgag agccccaggc gcgtttaccc ggtttcattt       420
     tcagttgagg cccaaatccc cccgggttgg tcggggcggg gcggggctcg ggggacgggg       480
     ctgaccgcgg ggcctgggcc agggtctcac accctccaga ggatgtacgg ctgcgacgtg       540
     gggccggacg ggcgcctcct ccgcgggcat gaccagtccg cctacgacgg caaggattac       600
     atcgccctga acgaggacct gagctcctgg accgcggcgg acacggcggc tcagatcacc       660
     cagcgcaagt gggaggcggc ccgtgaggcg gagcagtgga gagcctacct ggagggcctg       720
     tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca gcgc             774
//