spacer

EBI Dbfetch

ID   L38251; SV 1; linear; mRNA; STD; HUM; 1101 BP.
XX
AC   L38251;
XX
DT   21-JAN-2000 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens major histocompatibility complex class I (HLAC) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1101
RA   Hildebrand W.H., Ellexson M.E.;
RT   ;
RL   Unpublished.
XX
DR   MD5; 79909fc3cc16b37d0f146af1cc30b5ae.
XX
CC   GSDB:S:37526
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1101
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /haplotype="Cw*1603"
FT                   /cell_line="TC106 EBV transformed B cell line"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     1..72
FT                   /gene="HLAC"
FT   CDS             1..1101
FT                   /codon_start=1
FT                   /gene="HLAC"
FT                   /standard_name="MHC HLA-Cw*1603"
FT                   /product="major histocompatibility complex class I"
FT                   /note="glycosylation site aa 86, alpha 1 domain aa 25-114,
FT                   alpha 2 domain aa 115-206, alpha 3 domain aa 207-298,
FT                   transmembrane domain aa 299-337, and cytoplasmic domain aa
FT                   338-367; putative."
FT                   /db_xref="GOA:Q9MY34"
FT                   /db_xref="H-InvDB:HIT000193360.14"
FT                   /db_xref="IMGT/HLA:C*14:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY34"
FT                   /protein_id="AAF26750.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   mat_peptide     73..1098
FT                   /gene="HLAC"
FT                   /product="major histocompatibility complex class I"
FT                   /note="putative"
XX
SQ   Sequence 1101 BP; 213 A; 339 C; 376 G; 173 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg cctgctccca ctccatgagg tatttctaca ccgccgtgtc ccggcccggc       120
     cgcggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagtcc aagaggggag ccgcgggcgc cgtgggtgga gcaggagggg       240
     ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac tgaccgagtg       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     tggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg       480
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgcggc ggagcagcag       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga acacccaaag acacacgtga cccaccatcc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagtggg atggggagga ccaaactcag gacaccgagc ttgtggagac caggccagca       780
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacgtgcc atgtgcagca cgaggggctg ccggagcccc tcaccctgag atgggagccg       900
     tcttcccagc ccaccatccc catcgtgggc atcgttgctg gcctggctgt cctggctgtc       960
     ctagctgtcc taggagctgt ggtggctgtt gtgatgtgta ggaggaagag ctcaggtgga      1020
     aaaggaggga gctgctctca ggctgcgtcc agcaacagtg cccagggctc tgatgagtct      1080
     ctcatcgctt gtaaagcctg a                                                1101
//


spacer
spacer