Dbfetch

ID   L36980; SV 1; linear; genomic DNA; STD; HUM; 141 BP.
XX
AC   L36980;
XX
DT   16-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I (HLA-B) gene, HLA-B79V allele, exon 2 and partial
DE   cds.
XX
KW   cell surface antigen; class I gene; macronuclear;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-141
RA   Arnaiz-Villena A., Martinez-Laso J., Gomez-Casado E., Bedoya C.,
RA   Montoya F.;
RT   "HLA-B new alleles in South American Indians";
RL   Unpublished.
XX
DR   MD5; f02e86b40ee74350b192fe4151f1f817.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..141
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone="JK12.35 and JK12.36"
FT                   /cell_type="leukocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>141
FT                   /gene="HLA-B"
FT                   /number=2
FT                   /note="putative"
FT   CDS             <1..>141
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I"
FT                   /db_xref="IMGT/HLA:B*39:05:01"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WM99"
FT                   /protein_id="AAL31360.1"
FT                   /translation="FDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRN
FT                   L"
XX
SQ   Sequence 141 BP; 38 A; 39 C; 50 G; 14 T; 0 other;
     ggttcgacag cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg        60
     aggggccgga atattgggac cggaacacac agatctgcaa gaccaacaca cagacttacc       120
     gagagagcct gcggaacctg c                                                 141
//