Dbfetch

ID   L34102; SV 1; linear; mRNA; STD; HUM; 690 BP.
XX
AC   L34102;
XX
DT   17-JAN-1995 (Rel. 42, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 9)
XX
DE   Human (clone 1-33-4) MHC class II HLA-DQB1*0502 mRNA, 3' end.
XX
KW   cell surface glycoprotein; class II gene; integral membrane protein;
KW   major histocompatibility complex.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-690
RX   DOI; 10.1111/j.1399-0039.1996.tb02512.x.
RX   PUBMED; 8929711.
RA   Yasunaga S., Kimura A., Hamaguchi K., Ronningen K.S., Sasazuki T.;
RT   "Different contribution of HLA-DR and -DQ genes in susceptibility and
RT   resistance to insulin-dependent diabetes mellitus (IDDM)";
RL   Tissue Antigens 47(1):37-48(1996).
XX
DR   MD5; 437f041bd226bdc390062074785aa2e7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..690
FT                   /organism="Homo sapiens"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /cell_line="KAS011"
FT                   /cell_type="B lymphoblastoid"
FT                   /db_xref="taxon:9606"
FT   gene            1..690
FT                   /gene="HLA-DQB1"
FT   exon            <1..13
FT                   /gene="HLA-DQB1"
FT                   /number=1
FT                   /note="allele DQB1*0502; G00-120-517"
FT   CDS             <1..690
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II HLA-DQ-beta-1"
FT                   /function="immune regulation"
FT                   /note="allele DQB1*0502; putative"
FT                   /db_xref="GOA:Q30079"
FT                   /db_xref="H-InvDB:HIT000193147.9"
FT                   /db_xref="IMGT/HLA:DQB1*05:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q30079"
FT                   /protein_id="AAC41970.1"
FT                   /translation="RDSPEDFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVG
FT                   VYRAVTPQGRPSAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRRVEPTVTISPS
FT                   RTEALNHHNLLICSVTDFYPSHIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEM
FT                   TPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVLGLIFLGLGLIIRQR
FT                   SRKGLLH"
FT   exon            14..283
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT                   /note="allele DQB1*0502; G00-120-517"
FT   exon            284..565
FT                   /gene="HLA-DQB1"
FT                   /number=3
FT                   /note="allele DQB1*0502; G00-120-517"
FT   exon            566..676
FT                   /gene="HLA-DQB1"
FT                   /number=4
FT                   /note="allele DQB1*0502; G00-120-517"
FT   exon            577..>690
FT                   /gene="HLA-DQB1"
FT                   /number=6
FT                   /note="allele DQB1*0502; G00-120-517"
XX
SQ   Sequence 690 BP; 147 A; 193 C; 222 G; 128 T; 0 other;
     agagactctc ccgaggattt cgtgtaccag tttaagggcc tgtgctactt caccaacggg        60
     acggagcgcg tgcggggtgt gaccagacac atctataacc gagaggagta cgtgcgcttc       120
     gacagcgacg tgggggtgta ccgggcggtg acgccgcagg ggcggcctag cgccgagtac       180
     tggaacagcc agaaggaagt cctggagggg gcccgggcgt cggtggacag agtgtgcaga       240
     cacaactacg aggtggcgta ccgcgggatc ctgcagagga gagtggagcc cacagtgacc       300
     atctccccat ccaggacaga ggccctcaac caccacaacc tgctgatctg ctcggtgaca       360
     gatttctatc caagccacat caaagtccgg tggtttcgga atgatcagga ggagacagcc       420
     ggcgttgtgt ccacccccct cattaggaac ggtgactgga ccttccagat cctggtgatg       480
     ctggaaatga ctccccagcg tggagatgtc tacacctgcc acgtggagca ccccagcctc       540
     cagagcccca tcaccgtgga gtggcgggct cagtctgaat ctgcccagag caagatgctg       600
     agtggcgttg gaggcttcgt gctggggctg atcttccttg ggcttggcct tatcatccgt       660
     caaaggagtc ggaaagggct tctgcactga                                        690
//